DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheB42b and CheB98a

DIOPT Version :9

Sequence 1:NP_995763.1 Gene:CheB42b / 2768717 FlyBaseID:FBgn0066293 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_652269.3 Gene:CheB98a / 50092 FlyBaseID:FBgn0261289 Length:197 Species:Drosophila melanogaster


Alignment Length:178 Identity:68/178 - (38%)
Similarity:104/178 - (58%) Gaps:3/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YELLLEDPDIFSTCTDGPPGSINIRQALNLDDIVIDQKGDILHVSGNATVVWDVQPTDRITARLD 83
            |||.:.|.:|||:|.:..||:::|....:..:.....:.|.|.||||.|:|||:|..||:...:.
  Fly    22 YELSVADEEIFSSCPNPEPGTLDIHGLFDFSEFSTSLEADGLTVSGNQTLVWDIQRGDRVQLFIK 86

  Fly    84 VFHFNRGTWEPTVFSMATQNFCSIMYDKNQYWYKYWTRFITNRHEVEKKCFRGPDTVLVHEPFDL 148
            :|:|:||||..|.||:.:|:||..||||:...|:.||..:.|  :|:.:|...|.|.|:.:.:.|
  Fly    87 LFYFDRGTWTSTAFSILSQDFCKTMYDKSNVLYEPWTGHVMN--DVKDQCINAPGTKLILDTYFL 149

  Fly   149 ILKFENFRGPLLRGRHKLVILFNALDERNIPRPNPICLEIIGEPLKLQ 196
            .|. .:...||..||:|..|.|.|.|.:...||..||.|:||:..|::
  Fly   150 SLS-ASVTVPLREGRYKTTIKFRAFDSKGTERPTSICCEVIGDVFKIR 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheB42bNP_995763.1 DM11 17..180 CDD:128920 60/160 (38%)
CheB98aNP_652269.3 DM11 22..180 CDD:128920 60/160 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448904
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003852
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.