DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CheB42b and CheB42c

DIOPT Version :9

Sequence 1:NP_995763.1 Gene:CheB42b / 2768717 FlyBaseID:FBgn0066293 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_995764.2 Gene:CheB42c / 2768715 FlyBaseID:FBgn0066292 Length:196 Species:Drosophila melanogaster


Alignment Length:192 Identity:109/192 - (56%)
Similarity:146/192 - (76%) Gaps:0/192 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VLLLLLGVTSSWATDYELLLEDPDIFSTCTDGPPGSINIRQALNLDDIVIDQKGDILHVSGNATV 68
            ::|.:.|..||||.|||||||||||||.||:.|||||....|.::.|:|:||..||:|:|.:.|.
  Fly     4 LMLFVFGFASSWAADYELLLEDPDIFSPCTEPPPGSIGFHDAFDIGDLVVDQDMDIIHLSESVTS 68

  Fly    69 VWDVQPTDRITARLDVFHFNRGTWEPTVFSMATQNFCSIMYDKNQYWYKYWTRFITNRHEVEKKC 133
            :|||:|||||:||..:.|:|||:||||||||||.:||:.|:|:||.|:||||:.|:||.||.:||
  Fly    69 IWDVEPTDRISARFAIMHYNRGSWEPTVFSMATPDFCASMFDENQSWFKYWTKHISNRDEVMEKC 133

  Fly   134 FRGPDTVLVHEPFDLILKFENFRGPLLRGRHKLVILFNALDERNIPRPNPICLEIIGEPLKL 195
            |:...||::|.||||.|:..:.||..||||:|.|:.|.|:||:::||.|.||.||.||..|:
  Fly   134 FKTRGTVIMHNPFDLQLRLTDIRGATLRGRYKAVVTFEAVDEKDVPRRNSICFEIRGEAEKI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CheB42bNP_995763.1 DM11 17..180 CDD:128920 93/162 (57%)
CheB42cNP_995764.2 DM11 17..180 CDD:128920 93/162 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448873
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F5QI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003852
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.