DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir41a and grin2aa

DIOPT Version :9

Sequence 1:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_021329529.1 Gene:grin2aa / 563297 ZFINID:ZDB-GENE-070424-129 Length:1460 Species:Danio rerio


Alignment Length:197 Identity:46/197 - (23%)
Similarity:80/197 - (40%) Gaps:24/197 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 GKVYPNMSGDGALGMLINRKADICIGAMYSWYEDYTYLDLSMYLVRSGITCLVPAPLRLTSWYLP 344
            ||...|: .:|.:|.::|:||.:.:|::....|....:|.|:..|.:||:.:|.......|....
Zfish   483 GKKINNV-WNGMVGEVVNKKAVMAVGSLTINEERSEVIDFSVPFVETGISVMVSRSNGTVSPSAF 546

  Fly   345 LEPFKETLWAAILLCLCAEATGLVLAYKSEQALYVLP-GYR---------EGWWTCTSFGVCTTF 399
            ||||..::|..:.:.|.......|..::     |:.| |:.         .|........|...:
Zfish   547 LEPFSASVWVMMFVMLLLVTAMAVFMFE-----YISPLGFNRNLAQGKDPHGPSFTMGKAVWLLW 606

  Fly   400 KLFISQS---GNSKAYSLTVRVLLFACFLNDLIITSIYGGGLASILTIPSMDEAADTVTRLRFHR 461
            .|..:.|   .|.|..:....|.::|.|.  :|..:.|...||:.:.   .:|..|.||.|...:
Zfish   607 GLVFNNSVPVQNPKGTTSKFIVSVWAFFA--VIFLASYTANLAAFMI---QEEFVDQVTGLSDKK 666

  Fly   462 LQ 463
            .|
Zfish   667 FQ 668

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir41aNP_995744.4 None
grin2aaXP_021329529.1 PBP1_iGluR_NMDA_NR2 33..389 CDD:107373
PBP2_iGluR_NMDA_Nr2 400..799 CDD:270436 46/197 (23%)
NMDAR2_C 836..1460 CDD:313729
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.