Sequence 1: | NP_995744.4 | Gene: | Ir41a / 2768714 | FlyBaseID: | FBgn0040849 | Length: | 648 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021329529.1 | Gene: | grin2aa / 563297 | ZFINID: | ZDB-GENE-070424-129 | Length: | 1460 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 46/197 - (23%) |
---|---|---|---|
Similarity: | 80/197 - (40%) | Gaps: | 24/197 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 280 GKVYPNMSGDGALGMLINRKADICIGAMYSWYEDYTYLDLSMYLVRSGITCLVPAPLRLTSWYLP 344
Fly 345 LEPFKETLWAAILLCLCAEATGLVLAYKSEQALYVLP-GYR---------EGWWTCTSFGVCTTF 399
Fly 400 KLFISQS---GNSKAYSLTVRVLLFACFLNDLIITSIYGGGLASILTIPSMDEAADTVTRLRFHR 461
Fly 462 LQ 463 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ir41a | NP_995744.4 | None | |||
grin2aa | XP_021329529.1 | PBP1_iGluR_NMDA_NR2 | 33..389 | CDD:107373 | |
PBP2_iGluR_NMDA_Nr2 | 400..799 | CDD:270436 | 46/197 (23%) | ||
NMDAR2_C | 836..1460 | CDD:313729 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170591451 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |