DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir41a and Ir75d

DIOPT Version :9

Sequence 1:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_649074.2 Gene:Ir75d / 40065 FlyBaseID:FBgn0036829 Length:675 Species:Drosophila melanogaster


Alignment Length:406 Identity:74/406 - (18%)
Similarity:132/406 - (32%) Gaps:117/406 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SLHNKFV---FAHIANESPESRNHFFEDQPNILFVVRD-------HSSASSFDIKTNKFVGRKAE 176
            |.||.|.   |..:..|.|...: ..|| |.| |:..|       :.:..:|...........|.
  Fly   162 SEHNYFTTNRFWLLLTEDPGDID-LLED-PEI-FIPPDSELRVLHYENVGNFSCSLIDLYKVAAW 223

  Fly   177 NPSQMILVDRYLASEQRF-----QFGKSL-FADKLNNLQGREVIIAGFDYPPYTVIKHNMSTNAQ 235
            .|.:..||...:.:.:..     .||.:: :...|..:.....|:..|.         ::.||.:
  Fly   224 KPLKRTLVGHNIRNSRHVIHALQHFGSAITYRQDLEGIVFNSAIVIAFP---------DLFTNIE 279

  Fly   236 DMGVSGESDFKNVYIDGTETRIVLNFCEQFNCTIQIDSSAANDWGKVYPNMSGDGALGMLINRKA 300
            |:.:........|     ..|::|....:.|.:.....:....|.:  ||.|.||.:|.....:.
  Fly   280 DLSLRHIDTISKV-----NHRLMLELANRLNMSYNTYQTVNYGWRQ--PNGSFDGLMGRFQRYEL 337

  Fly   301 DICIGAMYSWYEDYTYLDL--SMYLVRSGITCLVPAPLRLTSWYLPLEPFKETLWAAILLCLCAE 363
            |:...|::...:....:|.  ..|.||:||....| ||...:....: ||:..:|.:||:.|...
  Fly   338 DLAQLAIFMRLDRIALVDFVAETYRVRAGIMFRQP-PLSAVANIFAM-PFENDVWVSILMLLIIT 400

  Fly   364 ATGLVLAYKSEQALYVLPGYREGWWTCTSFGVCTTFKLFISQSGNSKAYSLTV------------ 416
            ...|||                              :||.|...:..:|..|:            
  Fly   401 TVVLVL------------------------------ELFFSPHNHDMSYMDTLNFVWGAMCQQGF 435

  Fly   417 ---------RVLLFACFLNDLIITSIYGGGLASILTIPS-------------------------- 446
                     |:::|..|:..|.:.:.:...:.::|..||                          
  Fly   436 YVEVRNRSARIIVFTTFVAALFLFTSFSANIVALLQSPSDAIQSLSDLGQSPLEIGVQDTQYNKI 500

  Fly   447 -MDEAADTVTRLRFHR 461
             ..|:.|.||:..:|:
  Fly   501 YFTESTDPVTKNLYHK 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir41aNP_995744.4 None
Ir75dNP_649074.2 Periplasmic_Binding_Protein_Type_2 299..>483 CDD:304360 40/217 (18%)
Lig_chan 388..644 CDD:278489 24/159 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462944
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.