DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir41a and GluRIIA

DIOPT Version :9

Sequence 1:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_523484.2 Gene:GluRIIA / 33788 FlyBaseID:FBgn0004620 Length:907 Species:Drosophila melanogaster


Alignment Length:550 Identity:103/550 - (18%)
Similarity:191/550 - (34%) Gaps:152/550 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DKFEFQLLHKSDYISFVGINIKSFDDNGGHYIIDTGLKKKELQNKHLFLD------ELVIKIIIS 88
            |....|.|: |||     :.:::..|....|.|......:....:.:.||      :.::|:.|.
  Fly   181 DLMNIQALN-SDY-----VKLRNLADYADDYRILWKETDETFHEQRIILDCEPKTLKELLKVSID 239

  Fly    89 IE---------VTHCETF-----VVFDKDIDRFV----------NAF--NKASVYSIWRSLHNK- 126
            .:         :||.:|.     .::::|....:          |.|  .|..:..:.:.|.|: 
  Fly   240 FKLQGPFRNWFLTHLDTHNSGLRDIYNEDFKANITSVRLKVVDANPFERKKTRLTKVDQILGNQT 304

  Fly   127 ----------FVFAHIANE--------SPESRNHFFEDQPNIL--FVVRDHSSASSFDIKTNKFV 171
                      .:||..|..        .|.:| |.....|.:|  |:|.:..:.|..|::.:   
  Fly   305 MLPILIYDAVVLFASSARNVIAAMQPFHPPNR-HCGSSSPWMLGAFIVNEMKTISEDDVEPH--- 365

  Fly   172 GRKAENPSQMILVDRYLASEQRFQFGKSLFADKLN--------------NLQGREVIIAGF--DY 220
             .|.||    :.:|.|   .||..|...::...:|              .|...|:..||.  |:
  Fly   366 -FKTEN----MKLDEY---GQRIHFNLEIYKPTVNEPMMVWTPDNGIKKRLLNLELESAGTTQDF 422

  Fly   221 PP----YTVIKH------NMSTNAQDMGVSGESDFKNVYIDGTETRIVLNFCE--QFNCTIQIDS 273
            ..    |||:.|      .|..:.::.  .|...::...:|     ::....|  :|:....|  
  Fly   423 SEQRKVYTVVTHYEEPYFMMKEDHENF--RGREKYEGYAVD-----LISKLSELMEFDYEFMI-- 478

  Fly   274 SAANDWGKVYP-NMSGDGALGMLINRKADICIGAMYSWYEDYTYLDLSMYLVRSGITCL-VPAPL 336
              .|..||..| ....||.:..||:..|.|.:..:.......:.:|.::..::.||:.| ..:|.
  Fly   479 --VNGNGKYNPETKQWDGIIRKLIDHHAQIGVCDLTITQMRRSVVDFTVPFMQLGISILHYKSPP 541

  Fly   337 RLTSWYLPLEPFKETLWAAILLCLCAEATGLV----LAYKS----EQALYVLPGYREGWWTCTSF 393
            ...:.:..||||...:|..::..........|    |:|:.    ..|:.. |...|..|...: 
  Fly   542 EPKNQFAFLEPFAVEVWIYMIFAQLIMTLAFVFIARLSYREWLPPNPAIQD-PDELENIWNVNN- 604

  Fly   394 GVCTTFKLF--ISQSG-NSKAYSLTVRVLLFACFLNDLIITSIYGGGLASILTIPSMDEAADTVT 455
               :|:.:.  |.|.| :.......:|:|....:...|::.|.|...||:.||            
  Fly   605 ---STWLMVGSIMQQGCDILPRGPHMRILTGMWWFFALMMLSTYTANLAAFLT------------ 654

  Fly   456 RLRFHRLQWAANSEAWVSAIRASDEALVKD 485
                        |..|.|:|::..:.:.:|
  Fly   655 ------------SNKWQSSIKSLQDLIEQD 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir41aNP_995744.4 None
GluRIIANP_523484.2 PBP1_iGluR_Kainate 33..404 CDD:107377 43/240 (18%)
ANF_receptor 46..386 CDD:279440 42/222 (19%)
PBP2_iGluR_Kainate 426..796 CDD:270432 54/286 (19%)
Lig_chan 556..828 CDD:278489 25/145 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.