DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir41a and GluRIIC

DIOPT Version :9

Sequence 1:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_608557.4 Gene:GluRIIC / 33275 FlyBaseID:FBgn0046113 Length:940 Species:Drosophila melanogaster


Alignment Length:382 Identity:69/382 - (18%)
Similarity:129/382 - (33%) Gaps:117/382 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 PPYTVIKHNMSTNAQDMGVSGESDFKNVYID---------GTETRIVLNFCEQFNCTIQIDSSAA 276
            |||    .:.:..|:::.::|.:.::...:|         |.|...|....:|:.   ::|.. .
  Fly   431 PPY----FSYNETARELNLTGNALYQGYAVDLIDAIARHVGFEYVFVPVADQQYG---KLDKE-T 487

  Fly   277 NDWGKVYPNMSGDGALGMLINRKADICIGAMYSWYEDYTYLDLSMYLVRSGITCLV---PAPLRL 338
            ..|         :|.:|.:||..|.:.|..:.......|.:|.::..::.|::.|.   |...:.
  Fly   488 KQW---------NGIIGEIINNDAHMGICDLTITQARKTAVDFTVPFMQLGVSILAYKSPHVEKT 543

  Fly   339 TSWYLPLEPFKETLWAAILLCL-----------------------C------------AEATG-L 367
            ...|  |.||...:|..||:.:                       |            ...|| |
  Fly   544 LDAY--LAPFGGEVWIWILISVFVMTFLKTIVARISKMDWENPHPCNRDPEVLENQWRIHNTGWL 606

  Fly   368 VLAYKSEQALYVLPG------YREGWWTCTSFGVCTTFKLFISQS--GNSKAYSLTVRVLLFACF 424
            .:|........:||.      :...||         .|.:.|:.|  .|..|:..:.::......
  Fly   607 TVASIMTAGCDILPRSPQVRMFEATWW---------IFAIIIANSYTANLAAFLTSSKMEGSIAN 662

  Fly   425 LNDLI------ITSIYGGGLASILTIPSMDEAADTVTRLRFHRLQWAANSEAWVSAIRASDEALV 483
            |.||.      ..:||||...::|.     ::.:||.||.|:.:    |::        ...|..
  Fly   663 LKDLSAQKKVKFGTIYGGSTYNLLA-----DSNETVYRLAFNLM----NND--------DPSAYT 710

  Fly   484 KDILY----------NFHIYSDDELLRLAQDQHMRIGFTVERLPFGHFAIGNYLGPQ 530
            ||.|.          ::....:...|...::|:..:....|:....|:||....|.:
  Fly   711 KDNLEGVDRVRKNRGDYMFLMETTTLEYHREQNCDLRSVGEKFGEKHYAIAVPFGAE 767

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir41aNP_995744.4 None
GluRIICNP_608557.4 PBP1_iGluR_Kainate 26..404 CDD:107377
Periplasmic_Binding_Protein_Type_1 <279..363 CDD:299141
PBP2_iGluR_Kainate 423..794 CDD:270432 69/382 (18%)
Lig_chan 554..828 CDD:278489 42/240 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462657
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.