DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir41a and Ir7b

DIOPT Version :9

Sequence 1:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster


Alignment Length:517 Identity:112/517 - (21%)
Similarity:190/517 - (36%) Gaps:125/517 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 LVDRYLASEQRFQFGKSLFADKLNNLQGREVIIAGFDYPPYTVIKHNMSTNAQDMGVSGESDFKN 247
            :|:||....:|:. .:..|..||.|..|..:..|.::..||.|.:.:           |...|  
  Fly   183 VVNRYQVGTKRWA-SQDYFPSKLGNFYGCLLTCATWEDMPYLVWRPD-----------GSGSF-- 233

  Fly   248 VYIDGTETRIVLNF-CEQFNCTIQI------------DSSAANDWGKVYPNMSGDGALGMLINRK 299
            |.|:|.    :|.| .|..|.|:.:            |.|     |:::..:.|         ..
  Fly   234 VGIEGA----LLQFMAENLNFTVGLYWMNKEEVLATFDES-----GRIFDEIFG---------HH 280

  Fly   300 ADICIGAMYSW--------YEDYTYLDLSMYLVRSGITCLVPAPLRLTSWYLPLEPFKETLWAAI 356
            ||..:|..:..        |...||..:|..::.:.:.....|..:|:.      ||...||.||
  Fly   281 ADFSLGGFHFKPSAGSEIPYSQSTYYFMSHIMLVTNLQSAYSAYEKLSF------PFTPLLWRAI 339

  Fly   357 --LLCLCAEATGLVLAYKSEQALYVLPGYREGWWTCTSFGVCTTFKLFISQSGNSK----AYSLT 415
              :|.|......|::.::....|...|.|.               .|.::..||.:    .....
  Fly   340 GLVLILACLLLMLLVRWRHHHELPRNPYYE---------------LLVLTMGGNLEDRWVPQRFP 389

  Fly   416 VRVLLFACFLNDLIITSIYGGGLASILTIPSMDEAADTVTRL--RFHRLQWAANSEAWVSAIRAS 478
            .|::|.......|::.|.|..|:..:|...:......|::.:  :...:|.|..:||   .|.||
  Fly   390 SRLVLLTWLFATLVLRSGYQSGMYQLLRQDTQRNPPQTISEVLAQHFTIQLAEVNEA---RILAS 451

  Fly   479 DEALVKDILYNFHIYSDDELLR----LAQD--QHMRIGFTVERLPFGHFAIGNYLGPQAIDQLVI 537
            ...|..:.|    :|.:...|:    |||.  ...|:....   |:.:|.....:.|.: .:|.:
  Fly   452 LPELRPEQL----VYLEGSELQSFPALAQQSGSSARVAILT---PYEYFGYFRKVHPMS-RRLHL 508

  Fly   538 MKDDIYFQYTVAFVPRLWPLLDKLNTLIYSWHSSGFDKYWEYRVVA-----DNLNLKIQQQVQET 597
            :::.||.|....:|.|...|:..||..|...|:.||.::|..:.|:     |....:|......|
  Fly   509 VRERIYTQQLAFYVRRHSHLVGVLNKQIQHAHTHGFLEHWTRQYVSAVDEKDESVARIASTSYST 573

  Fly   598 MTG------------TKDIGPV---PLGMSNFAG--FIIVWI-LGSAIATLTFLLELSLTYI 641
            :.|            .:.:.||   .|.|...|.  ::|:|. ||   |.:.|:|||.|..|
  Fly   574 LDGIDGDPSLSESEEDQQVAPVRQNVLSMRELAALFWLILWANLG---AVVVFVLELLLPRI 632



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463052
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.