DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir41a and GRIN2A

DIOPT Version :9

Sequence 1:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster
Sequence 2:XP_016878661.1 Gene:GRIN2A / 2903 HGNCID:4585 Length:1516 Species:Homo sapiens


Alignment Length:252 Identity:56/252 - (22%)
Similarity:98/252 - (38%) Gaps:35/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 IKHNMSTNAQDMGVSGESDFKNVYIDGTETRIVLNFCEQFNCTIQIDSSAANDWGKVYPNMSGDG 290
            :|.|.|||.   |::.:...|...||     |:.........|..:........||...|: .:|
Human   492 VKINNSTNE---GMNVKKCCKGFCID-----ILKKLSRTVKFTYDLYLVTNGKHGKKVNNV-WNG 547

  Fly   291 ALGMLINRKADICIGAMYSWYEDYTYLDLSMYLVRSGITCLVPAPLRLTSWYLPLEPFKETLWAA 355
            .:|.::.::|.:.:|::....|....:|.|:..|.:||:.:|.......|....||||..::|..
Human   548 MIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVM 612

  Fly   356 ILLCLCAEATGLVLAYKSEQALYVLP-GYR---------EGWWTCTSFGVCTTFKLFISQS---G 407
            :.:.|...:...|..::     |..| ||.         .|........:...:.|..:.|   .
Human   613 MFVMLLIVSAIAVFVFE-----YFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQ 672

  Fly   408 NSKAYSLTVRVLLFACFLNDLIITSIYGGGLASILTIPSMDEAADTVTRL---RFHR 461
            |.|..:..:.|.::|.|.  :|..:.|...||:.:.   .:|..|.||.|   :|.|
Human   673 NPKGTTSKIMVSVWAFFA--VIFLASYTANLAAFMI---QEEFVDQVTGLSDKKFQR 724



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156039
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.