DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir41a and GRIK3

DIOPT Version :9

Sequence 1:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_000822.2 Gene:GRIK3 / 2899 HGNCID:4581 Length:919 Species:Homo sapiens


Alignment Length:589 Identity:107/589 - (18%)
Similarity:197/589 - (33%) Gaps:154/589 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 RFVNAFNKASVYSIWRSLHNKFVFAHIANESPESRNHFFEDQPNILFVVRD-------HSSASSF 163
            ||:|...:|.    |..|..:.||    |::...|..|..|   |:.:..|       .|.|...
Human   361 RFMNFIKEAQ----WEGLTGRIVF----NKTSGLRTDFDLD---IISLKEDGLEKVGVWSPADGL 414

  Fly   164 DIKTNKFVGRKAENPSQMILVDRYLASEQRFQFGKSLFADKLNNLQGREVIIAGFDYPPYTVIKH 228
            :| |....||   .|:                     ..|.|.|   |.:|:......|:.:.:.
Human   415 NI-TEVAKGR---GPN---------------------VTDSLTN---RSLIVTTVLEEPFVMFRK 451

  Fly   229 NMSTNAQDMGVSGESDFKNVYID-GTETRIVLNFCEQFNCTIQIDSSAANDWGKVYPNMSGDGAL 292
            :      |..:.|...|:...|| ..|...:|.|..:..........|.:|.|:      .:|.:
Human   452 S------DRTLYGNDRFEGYCIDLLKELAHILGFSYEIRLVEDGKYGAQDDKGQ------WNGMV 504

  Fly   293 GMLINRKADICIGAMYSWYEDYTYLDLSMYLVRSGITCLVPAPLRLT-SWYLPLEPFKETLWAAI 356
            ..||:.|||:.:..:...:.....:|.|...:..|::.|...|.... |.:..|.|....:|..:
Human   505 KELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYV 569

  Fly   357 LLC-LCAEATGLVLA----YKSEQALYVLPGYR---------EGWWTCTSFGVCTTFKLFISQSG 407
            ||. |.......|:|    |:...|....||..         ..:|    ||:.:    .:.|..
Human   570 LLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNSFW----FGMGS----LMQQGS 626

  Fly   408 NSKAYSLTVRVLLFACFLNDLIITSIYGGGLASILTIPSMDEAADTV------TRLRFHRLQ--- 463
            .....:|:.|::....:...|||.|.|...||:.||:..|:...|:.      |::.:..::   
Human   627 ELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGA 691

  Fly   464 ----------------WAANSEAWVSAIRASDEALVKDILYNFHIYSDDELLRLAQDQH---MRI 509
                            ||..|....:.::.::|.:.:.:..::.:..:...:.....::   .:|
Human   692 TMTFFKKSKISTFEKMWAFMSSKPSALVKNNEEGIQRALTADYALLMESTTIEYVTQRNCNLTQI 756

  Fly   510 GFTVERLPFGHFAIGNYLGPQAIDQLVIMKDDIYFQYTVAFVPRLWPLLDKLNTLIYSWHSSGFD 574
            |..::...:|   ||..:|....|::.|....:..:..:..:...|            |..||..
Human   757 GGLIDSKGYG---IGTPMGSPYRDKITIAILQLQEEDKLHIMKEKW------------WRGSGCP 806

  Fly   575 KYWEYRVVADNLNLKIQQQVQETMTGTKDIGPVPLGMSNFAGFIIVWILGSAIATLT----FLLE 635
                            :::.:|...         ||:....|..||...|..::.|.    |:.:
Human   807 ----------------EEENKEASA---------LGIQKIGGIFIVLAAGLVLSVLVAVGEFVYK 846

  Fly   636 LSLT 639
            |..|
Human   847 LRKT 850

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir41aNP_995744.4 None
GRIK3NP_000822.2 PBP1_iGluR_Kainate_GluR5_7 34..417 CDD:107388 17/67 (25%)
ANF_receptor 55..398 CDD:279440 13/47 (28%)
PBP2_iGluR_Kainate_GluR7 433..801 CDD:270441 70/405 (17%)
Lig_chan 564..832 CDD:278489 50/315 (16%)
Glutamate binding. /evidence=ECO:0000250 690..692 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156182
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.