DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir41a and Grin2a

DIOPT Version :10

Sequence 1:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_032196.2 Gene:Grin2a / 14811 MGIID:95820 Length:1464 Species:Mus musculus


Alignment Length:86 Identity:15/86 - (17%)
Similarity:23/86 - (26%) Gaps:38/86 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 CSEAELNPDGTCGYDYPKPPNPLT------LPPKIPTTTVRTTPA-------------------- 250
            |.||.|...|...:.:.......|      ||.:...|.:.:|..                    
Mouse   152 CEEALLRVKGVISFTFQMALKRCTVRIRADLPTESLATAIASTKVLSAKQVVKDENGEEVLIPLS 216

  Fly   251 ------------PEYLPPDET 259
                        |:|||.:|:
Mouse   217 TSGSKVEENSHLPDYLPEEES 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir41aNP_995744.4 None
Grin2aNP_032196.2 PBP1_iGluR_NMDA_NR2 32..387 CDD:380601 15/86 (17%)
PBP2_iGluR_NMDA_Nr2 403..802 CDD:270436
NMDAR2_C 839..1464 CDD:463148
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.