DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir41a and Grin2a

DIOPT Version :9

Sequence 1:NP_995744.4 Gene:Ir41a / 2768714 FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster
Sequence 2:NP_032196.2 Gene:Grin2a / 14811 MGIID:95820 Length:1464 Species:Mus musculus


Alignment Length:252 Identity:56/252 - (22%)
Similarity:98/252 - (38%) Gaps:35/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 IKHNMSTNAQDMGVSGESDFKNVYIDGTETRIVLNFCEQFNCTIQIDSSAANDWGKVYPNMSGDG 290
            :|.|.|||.   |::.:...|...||     |:.........|..:........||...|: .:|
Mouse   440 VKINNSTNE---GMNVKKCCKGFCID-----ILKKLSRTVKFTYDLYLVTNGKHGKKVNNV-WNG 495

  Fly   291 ALGMLINRKADICIGAMYSWYEDYTYLDLSMYLVRSGITCLVPAPLRLTSWYLPLEPFKETLWAA 355
            .:|.::.::|.:.:|::....|....:|.|:..|.:||:.:|.......|....||||..::|..
Mouse   496 MIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLEPFSASVWVM 560

  Fly   356 ILLCLCAEATGLVLAYKSEQALYVLP-GYR---------EGWWTCTSFGVCTTFKLFISQS---G 407
            :.:.|...:...|..::     |..| ||.         .|........:...:.|..:.|   .
Mouse   561 MFVMLLIVSAIAVFVFE-----YFSPVGYNRNLAKGKAPHGPSFTIGKAIWLLWGLVFNNSVPVQ 620

  Fly   408 NSKAYSLTVRVLLFACFLNDLIITSIYGGGLASILTIPSMDEAADTVTRL---RFHR 461
            |.|..:..:.|.::|.|.  :|..:.|...||:.:.   .:|..|.||.|   :|.|
Mouse   621 NPKGTTSKIMVSVWAFFA--VIFLASYTANLAAFMI---QEEFVDQVTGLSDKKFQR 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir41aNP_995744.4 None
Grin2aNP_032196.2 PBP1_iGluR_NMDA_NR2 32..392 CDD:107373
PBP2_iGluR_NMDA_Nr2 403..802 CDD:270436 56/252 (22%)
HisJ <458..>541 CDD:223904 18/88 (20%)
Lig_chan 556..828 CDD:278489 26/127 (20%)
NMDAR2_C 839..1464 CDD:287527
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.