DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG34260

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster


Alignment Length:135 Identity:31/135 - (22%)
Similarity:54/135 - (40%) Gaps:18/135 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHK-VPITKVKVNFSLLK----RFNGY 134
            :....:.|....||:.:...|.|  |.:....:::|.:|:: :....|...|.|:|    |.|  
  Fly    25 IAIKTLGCQIIAKAYVNSLECLL--VRQRTAVVAVKFSLNQTIEHFDVLATFDLIKKDKSRMN-- 85

  Fly   135 KPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDI 199
               :.:|.:|.||.|.....|.|....:...|..||:..:||.....:.|.....|::.      
  Fly    86 ---IADIKIDGCKYLGSMYQNNIVGKLFKRLKSVSNLPDSCPVSKGKLYEIRNYTFISD------ 141

  Fly   200 KFPHG 204
            :||.|
  Fly   142 EFPPG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 22/86 (26%)
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.