DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG14518

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:164 Identity:55/164 - (33%)
Similarity:87/164 - (53%) Gaps:22/164 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVN-LHKVPITKVKVNFSLLKRFNGYK 135
            |.:.:.||..|.:::|::.:|..|.|::|:|:...|::..| ||  |:..|.|...||||.||||
  Fly    22 AVIFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH--PVHDVIVKARLLKRANGYK 84

  Fly   136 PFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPF-------DHDLIVEKLPTNFMNQ 193
            |:||:::.|.|:.:|. :.|.:....:.|||.:|.:|||||:       :..|..|||||     
  Fly    85 PWLYSVSFDGCQFIRR-RNNALIRIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLPT----- 143

  Fly   194 KVNGDIKFPHGDYLFHSDWYAYGINRATVDFFLT 227
                  ..|.|:||...||......:|..:.:.|
  Fly   144 ------PIPTGEYLLMIDWVFNKKPQAATNVYFT 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 34/91 (37%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 32/101 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472348
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.890

Return to query results.
Submit another query.