DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG13590

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:157 Identity:50/157 - (31%)
Similarity:87/157 - (55%) Gaps:10/157 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKV-PITKVKVNFSLLKRFNGYK 135
            |..::.||..|.|::|::....||.||:.:|:  ..||.:|:..| |...:.|:|..:|:.||||
  Fly    22 APYLKMTNAVCKSYNKSWVVVHYCRLKAYSRA--KTSLNINVTFVEPARNISVHFKTMKKANGYK 84

  Fly   136 PFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDIK 200
            |||::.|.|||:.:|. :..|:....:.:.::.|.:|||||::.    .::.::|  .||:..:.
  Fly    85 PFLFDYTFDACEFMRR-RNQPVAKIIWYMIRNVSTINHTCPYEG----LQMLSDF--HKVDIPVP 142

  Fly   201 FPHGDYLFHSDWYAYGINRATVDFFLT 227
            .|.||||...||...|..:...:.:.|
  Fly   143 LPSGDYLLMVDWLFDGKTQFATNVYFT 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 29/84 (35%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 29/94 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472349
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
87.890

Return to query results.
Submit another query.