DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG33919

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:155 Identity:44/155 - (28%)
Similarity:72/155 - (46%) Gaps:36/155 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 MYKIPVTKVKIASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLK----VNLHKVPITKV 121
            :||:.    ||..||..|.:...|          ||:|::|.:...:::.    |.||. ||.::
  Fly    23 VYKLK----KIECLVNRTRVSNVS----------CHVKAINWNLAVVNMDCFMIVPLHN-PIIRM 72

  Fly   122 KV---NFSLLKRFNGYKPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIV 183
            :|   ::|     |.|||||.::.:..|:.:....:.|.....:.|||.::|:||:|||...||.
  Fly    73 QVFTKDYS-----NQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIA 132

  Fly   184 EK--LPTNFMNQKVNGDIKFPHGDY 206
            ..  |.|:.:.       .||.|.|
  Fly   133 RDGFLDTSLLP-------PFPQGFY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 27/89 (30%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 27/93 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472350
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.