DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG33725

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:157 Identity:52/157 - (33%)
Similarity:79/157 - (50%) Gaps:22/157 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IPVTKVKIASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLK-VNLHKVPITKVKVNFSL 127
            |.|..:..|.:.:|||..|.|.::::..|..|.||:|:|....|:.. ..||  |...:.|:..|
  Fly    16 ILVIDLNDAVVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLH--PANNIIVHVKL 78

  Fly   128 LKRFNGYKPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPF-------DHDLIVEK 185
            .|:.||:||:|.::.:|||:.:| :.::|.....:.|||..|.:|||||:       |..|..||
  Fly    79 FKKANGFKPWLLDVKLDACRFVR-TNFHPFVRIIFDLFKDFSTINHTCPYVGLQVVKDFYLRPEK 142

  Fly   186 LPTNFMNQKVNGDIKFPHGDYLFHSDW 212
            |           .:.||.||||....|
  Fly   143 L-----------KLPFPSGDYLLSLIW 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 32/91 (35%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472342
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.