DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG33770

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001027144.2 Gene:CG33770 / 3772256 FlyBaseID:FBgn0053770 Length:185 Species:Drosophila melanogaster


Alignment Length:94 Identity:21/94 - (22%)
Similarity:39/94 - (41%) Gaps:9/94 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYKPF--LYNITVDACKAL 149
            |.|::|.:     ..|:.| :.|.:.|.|..:...:.......|....|.|  |::.::|.|..:
  Fly    44 KYFENFTF-----TIRNDK-IFLDMYLRKPLVRGWRARLDFRTRVGNSKSFQSLFSTSIDVCNIV 102

  Fly   150 RHSKYNPIFSFFYGLFKHHSNMNHTCPFD 178
            ..:|.| :|..:|.....:.|....||.:
  Fly   103 NAAKIN-LFKKWYKNLLKYGNFLRQCPLN 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 13/58 (22%)
CG33770NP_001027144.2 DM8 88..178 CDD:214778 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448064
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.