DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG33688

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster


Alignment Length:155 Identity:56/155 - (36%)
Similarity:90/155 - (58%) Gaps:2/155 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 VEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYKPFLY 139
            |.|||:||....:....||.|.:|:|||:.||:.:.||||:..:..|.| ..|::..||||||..
  Fly    21 VTFTNLKCGIRGEKIYYFEKCFIKAVNRTHKYIDIYVNLHQQVVNNVTV-IKLMRHNNGYKPFFV 84

  Fly   140 NITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDIKFPHG 204
            ::|:|.||.|:..:.: |....|.::|::||:|||||:...:||..|.|..:.......:....|
  Fly    85 DVTIDVCKFLKDPRQS-IIKKLYDIYKNNSNINHTCPYKDVVIVHHLWTGNLESDFMKYLPLIDG 148

  Fly   205 DYLFHSDWYAYGINRATVDFFLTLS 229
            ||..:::|..|.:.||.:|.::.:|
  Fly   149 DYAIYTEWSVYNVARAFIDVYIRVS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 30/84 (36%)
CG33688NP_001027131.1 DUF1091 72..152 CDD:284008 29/80 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.