DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG33783

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster


Alignment Length:155 Identity:56/155 - (36%)
Similarity:86/155 - (55%) Gaps:11/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 NIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYKPFLYNITV 143
            |||||.::|:|.:.:.|.||.:.|....|.|....|::||.......||.:|||||:|||||:||
  Fly    12 NIKCTCYEKSFCELKRCELKVLGRGIVGLFLHAQAHQLPINSSTCILSLYRRFNGYRPFLYNMTV 76

  Fly   144 DACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDIKFPHGDY-- 206
            |.|...::.|..|.....|...|:.||:||:||.:||:||.::   .:|..:...:.||.|.|  
  Fly    77 DICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDIIVNRM---VLNDNMIVKVPFPSGFYKL 138

  Fly   207 --LFHSDWYAYGINRATVDFFLTLS 229
              :..:|    ||.|..|:.::.::
  Fly   139 MFILKTD----GIWRGEVEVYVEVN 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 35/88 (40%)
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 34/80 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472153
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.