DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG33796

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:178 Identity:53/178 - (29%)
Similarity:85/178 - (47%) Gaps:31/178 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KY---ISVKVRMYKIPVTKVKIASLVEFTNIKCTSWDKAFDDFEYCHLKSVNR---------SFK 105
            ||   |.|.:.:..:.:.|.....:.:.||:.|.|::|.:.....|.||::||         :|.
  Fly     2 KYVLKIVVSLTILCLMILKPSNPVVFKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFL 66

  Fly   106 YLSLKVNLHKVPITKVKVNFSLLKRFNGYKPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSN 170
            |          |...:.|::...||.|||:|:|.|..:|.|:.|| ..|:.:....:.::::.:|
  Fly    67 Y----------PTKSITVHYQTFKRENGYRPWLVNTQIDGCRFLR-KPYDALGILLFNIYRNFTN 120

  Fly   171 MNHTCPFDHDLIVEK--LPTNFMNQKVNGDIKFPHGDYLFHSDWYAYG 216
            :|||||...|:||..  |.|:.|.      :..|.||||...||..||
  Fly   121 INHTCPLQGDMIVRNMYLTTDVMR------LPLPTGDYLLAIDWIFYG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 30/86 (35%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 30/86 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472340
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.