DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG33768

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster


Alignment Length:239 Identity:49/239 - (20%)
Similarity:83/239 - (34%) Gaps:92/239 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VKYKLLIIVIFHSVNMSTSDFEFTNIKCTSLDKDFDDFEYCHLKSVNRT--------------FK 53
            :|...:::|||.|..:|:| .....::|   :|:...|...::.|||.|              |:
  Fly     2 LKIVCVLMVIFVSQAVSSS-VTLNRVQC---EKNAKFFATLNVTSVNSTIYADIELLQALKAGFR 62

  Fly    54 -YISVKVRMYKIPVTKVKIASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVP 117
             ::.|::|:....    |..|||:             .|.:||.|.|        :||.:|.:..
  Fly    63 GHVDVQLRLSNAK----KFQSLVQ-------------ADTDYCELLS--------TLKDSLFRRW 102

  Fly   118 ITKVKVNFSLLKRFNGYKPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLI 182
            |..|..|.:.::.               |         |:.:..|.|...|..|.          
  Fly   103 IKSVSKNSNFMEN---------------C---------PVPAGHYYLKGWHVEMG---------- 133

  Fly   183 VEKLPTNFMNQKVNGDIKFPHGDYLFHSDWYAYGINRATVDFFL 226
              .:|:..::           ||||..:..| ||..|:....||
  Fly   134 --LVPSYLLS-----------GDYLLSALVY-YGKYRSKKQMFL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 11/84 (13%)
CG33768NP_001027142.2 DM8 76..167 CDD:214778 32/157 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447984
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.