DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG33703

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster


Alignment Length:160 Identity:42/160 - (26%)
Similarity:69/160 - (43%) Gaps:28/160 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TNIKCTSWDKAFDDFEYCHL--KSVNRSFKYLSLKVNLHKVPITKVKVNFSLL-----KRFNGYK 135
            :.::|.|.|.:|..|:.|.:  :...|:..|:| :|.|:|.||..:.:|..:.     :||.   
  Fly    27 SKMECRSLDPSFTYFKTCKVVRRENGRAALYVS-EVFLYKDPIDDIVLNLGVFRIAKNRRFQ--- 87

  Fly   136 PFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVNGDIK 200
             || |.|:|.|...|....:..|.|........||:|.|||...::......   :::....:|.
  Fly    88 -FL-NETLDYCLFSRQYLASGFFGFLMTPLLRISNLNATCPLQQNITFNGFS---VDENTIKEIP 147

  Fly   201 FPHGDYLFH------SDW------YAYGIN 218
            .|:|.|:||      ..|      ||..:|
  Fly   148 IPNGVYMFHLRSSLMKKWRTDVKVYATRVN 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 22/89 (25%)
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.