DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG14492

DIOPT Version :10

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster


Alignment Length:166 Identity:37/166 - (22%)
Similarity:65/166 - (39%) Gaps:33/166 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 MYKIPVTKVKIASLVEF----TNIKCTSWDKAFDDFEYCHLK----SVNRSFKYLSLKVN-LHKV 116
            :|.:|..|::..:...|    .|..|:|     ||.....||    .:::|.|..:..:. :.:.
  Fly    16 LYLLPNWKLEAEAKNNFELQTDNFTCSS-----DDISSSVLKEFTCGISKSTKRRTWHMEFVLEQ 75

  Fly   117 PITK----VKVNFSLLKRFNGYKPF-LYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCP 176
            |:.:    :|:   :|.|......| |.|:|.|.|:.|.:....|:......:.:..||....||
  Fly    76 PVAEHDFFIKI---VLPRRRPLPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCP 137

  Fly   177 FDHD---------LIVEKLPTNFMNQKVNGDIKFPH 203
            |..:         |.:..:|...|...|  .|:|.|
  Fly   138 FKPNFTYYIRGFRLDLNLVPAVDMETPV--QIEFSH 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:461928 22/91 (24%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 20/79 (25%)

Return to query results.
Submit another query.