DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG13198

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster


Alignment Length:158 Identity:58/158 - (36%)
Similarity:85/158 - (53%) Gaps:12/158 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LVEFTNIKC----TSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGY 134
            |::|||:||    ||  :....:||||||.|.|:...|||||:|.::||..:.......:|.:||
  Fly    24 LLKFTNVKCMDLPTS--RGLTKYEYCHLKVVRRNQVELSLKVSLFQLPIRNLTTRLQCFQRRDGY 86

  Fly   135 KPFLYNITVDACKALRHSKYNPIFS-FFYGLFKHHSNMNHTCPF-DHDLIVEKLPTNFMNQKVNG 197
            :||:|.|..|.||.:....|:..|. |.:...:..||.|.|||: ::.:.|||...:|  .|:: 
  Fly    87 RPFMYYILFDFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKENHMTVEKFALDF--TKIS- 148

  Fly   198 DIKFPHGDYLFHSDWYAYGINRATVDFF 225
             :..|.|.|.....:|||||.|.....|
  Fly   149 -MPVPAGTYRLGFTFYAYGIARTLTQVF 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 27/86 (31%)
CG13198NP_610690.1 DM8 86..179 CDD:214778 32/94 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472121
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.