DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG33454

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:150 Identity:60/150 - (40%)
Similarity:87/150 - (57%) Gaps:19/150 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVN---LHKVPITKVKVNFSLLKRFNG 133
            :::|:.||:.|.|:||:...|.||.||:.:|:  ..||.:|   ||  ||..:.|.|.:|||.||
  Fly    22 SAMVKMTNVVCESYDKSLTVFHYCRLKAYSRT--KTSLHINATFLH--PINSISVRFQMLKRANG 82

  Fly   134 YKPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMN--QKVN 196
            |||||::||||||:.||... ||:....|.:.|..||:||:||:.         |..:|  .:::
  Fly    83 YKPFLFDITVDACQFLRKPN-NPVIKIVYNMIKDASNINHSCPYG---------TVVLNDFHRIS 137

  Fly   197 GDIKFPHGDYLFHSDWYAYG 216
            ..:.||.||||...|:...|
  Fly   138 LPLPFPSGDYLSRLDFLING 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 37/86 (43%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 36/85 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472345
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.