DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG33467

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:192 Identity:44/192 - (22%)
Similarity:75/192 - (39%) Gaps:43/192 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 HLKSVNRTFKYISVKVRMYKIPVTKVKIASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLS 108
            |:......:|:..|:.:..:..|..|.       .|:|..:|:.|..:.: |:|         :.
  Fly    16 HMTDSQLVYKFTKVECQGNQARVKNVS-------CNVKPINWNTALVNLD-CYL---------IY 63

  Fly   109 LKVNLHKVPITKVKVNFSLLKRF-NGYKPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMN 172
            ..:|    |..:|:|   .:|.: |.|||||.:.|...|..:....:.|.....:.||:..:|:.
  Fly    64 PLIN----PTIRVQV---FMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK 121

  Fly   173 HTCPFDHDLIVEKLPTNFMNQKVNGDI--KFPHGDY---LFHSDWYAYGINR---ATVDFFL 226
             :|.....|       :..|..:|...  .||||.|   :..||  :...||   ..|.||:
  Fly   122 -SCHISGQL-------SARNGYLNSSYVPPFPHGQYQISVMFSD--SNSTNREFVGIVKFFV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 23/90 (26%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472341
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.