DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG33476

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_995798.2 Gene:CG33476 / 2768727 FlyBaseID:FBgn0053476 Length:165 Species:Drosophila melanogaster


Alignment Length:160 Identity:38/160 - (23%)
Similarity:59/160 - (36%) Gaps:49/160 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HSVNMST-----SDFEFTNIKCTSLDKDFDDFEYCHLKSVNRTFKYISVKVRMYKIPVTKVKIAS 73
            |||:..:     |.|...:: .||.|.:|  .||.| |:.:        .|.:|...|.|:..|.
  Fly     5 HSVDQCSRFRGGSKFIMESL-ATSCDHNF--VEYFH-KAPD--------MVDIYTFRVVKLAKAF 57

  Fly    74 LVEFTNIKCTSWDKAF---DDFEYCHL---KSVNRSF--KYLSLKVN--LHKVPITKVKVNFSLL 128
            .::|. ::.....:..   |:|:.|..   ..:||.|  .|..|.||  ....||          
  Fly    58 TIDFA-VRVVKTKRVMYKVDNFDGCQFLMNPLMNRVFGTVYKRLVVNGSFFSCPI---------- 111

  Fly   129 KRFNGYKPFLYNITVDACKALRHSKYNPIF 158
                  ||.:|.|..:...|:.     |:|
  Fly   112 ------KPGVYYIRNEGSVAML-----PVF 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 7/36 (19%)
CG33476NP_995798.2 DUF1091 57..138 CDD:284008 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.