DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33483 and CG33477

DIOPT Version :9

Sequence 1:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster


Alignment Length:174 Identity:34/174 - (19%)
Similarity:54/174 - (31%) Gaps:75/174 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VKYKLLIIVIFHSVNMSTSDFEFTNIKCTSLDK--DFDDFEYCH-------------LK-----S 47
            |||    :.|...:.:...:.|::   ..|||.  |.|..||.|             :|     :
  Fly    34 VKY----LTIPQPIAVQRGNAEYS---LESLDTRCDHDFVEYFHRVPDSKILYTFRVVKLAPAFT 91

  Fly    48 VNRTFKYISVKVRMYKIPVTKVKIASLVEFTNIKCTSWDKAFDDFEYCH-------LKSVNRSFK 105
            :|.|.|.:.....||||                         ::|:.|.       .|....|:|
  Fly    92 INITIKVLKTHRIMYKI-------------------------ENFKGCEFLNNPVIFKMFGESYK 131

  Fly   106 YLSLKVNLHKVPITKVKVNFSLLKRFNGYKPFLYNITVDACKAL 149
            .|.:..:..|.||                ||.:|.:..|...::
  Fly   132 TLVVNGSYFKCPI----------------KPNVYYLKTDGIMSM 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 4/27 (15%)
CG33477NP_995797.1 DUF1091 100..171 CDD:284008 17/101 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.