powered by:
Protein Alignment CG33483 and CG33475
DIOPT Version :9
Sequence 1: | NP_001189327.1 |
Gene: | CG33483 / 2768693 |
FlyBaseID: | FBgn0053483 |
Length: | 229 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_995799.1 |
Gene: | CG33475 / 2768724 |
FlyBaseID: | FBgn0053475 |
Length: | 147 |
Species: | Drosophila melanogaster |
Alignment Length: | 40 |
Identity: | 11/40 - (27%) |
Similarity: | 19/40 - (47%) |
Gaps: | 2/40 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 138 LYNI-TVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCP 176
:||| .:..|..|.:...:.::|..|..|..:|.: ..||
Fly 56 IYNIKNLAICNFLNNRLISKVYSVIYEGFVGNSTV-FRCP 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.