powered by:
Protein Alignment Dup99B and SP
DIOPT Version :9
Sequence 1: | NP_996305.1 |
Gene: | Dup99B / 2768691 |
FlyBaseID: | FBgn0250832 |
Length: | 54 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_524057.2 |
Gene: | SP / 39494 |
FlyBaseID: | FBgn0003034 |
Length: | 55 |
Species: | Drosophila melanogaster |
Alignment Length: | 57 |
Identity: | 27/57 - (47%) |
Similarity: | 34/57 - (59%) |
Gaps: | 7/57 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MKTPLFLLLVVLASLLGLALSQD----RNDTEW-IQSQKDREKWCRLNLGPYLGGRC 52
||| ..|.:||..:|||..:.: |..|:: |.|...|:|||||||||..||||
Fly 1 MKT--LALFLVLVCVLGLVQAWEWPWNRKPTKFPIPSPNPRDKWCRLNLGPAWGGRC 55
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45453083 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0019717 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.930 |
|
Return to query results.
Submit another query.