DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33346 and Endog

DIOPT Version :10

Sequence 1:NP_996301.2 Gene:CG33346 / 2768690 FlyBaseID:FBgn0053346 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_031957.1 Gene:Endog / 13804 MGIID:1261433 Length:294 Species:Mus musculus


Alignment Length:179 Identity:52/179 - (29%)
Similarity:75/179 - (41%) Gaps:35/179 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ELYRSCYDARTMKAYFSINTVYPTNLK--SDRPPTVFDKDGIITPADEATFQMNSIYNRFEYLFG 186
            |.|...||.||..|.:.:..:.|..|:  .||....|.:|..:.....||   |:.|.      |
Mouse    76 ESYVLSYDPRTRGALWVLEQLRPERLRGDGDRSACDFREDDSVHAYHRAT---NADYR------G 131

  Fly   187 SGQTYVPSSRSLSFDRGHLTPVADYSFPKILRQTNKYL-NVVPQYYNINRSNWKIVENWVRGQKD 250
            ||           ||||||...|::.:.:.......|| ||.||..::|::.|..:|.:.|....
Mouse   132 SG-----------FDRGHLAAAANHRWSQRAMDDTFYLSNVAPQVPHLNQNAWNNLERYSRSLTR 185

  Fly   251 V---LNVCTGALGVLDLLNRSQ---KSVSIYLAPNKN--PVPRWTYKII 291
            .   :.||||.|    .|.|::   ||...|....||  .||...:|::
Mouse   186 TYQNVYVCTGPL----FLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33346NP_996301.2 Endonuclease_NS 124..344 CDD:214889 52/179 (29%)
EndogNP_031957.1 NUC 75..281 CDD:214683 52/179 (29%)
Essential for deoxyribonuclease activity. /evidence=ECO:0000269|PubMed:32192768 283..293
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.