DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCAP-R and PTGER4

DIOPT Version :9

Sequence 1:NP_001368957.1 Gene:CCAP-R / 2768688 FlyBaseID:FBgn0039396 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_000949.1 Gene:PTGER4 / 5734 HGNCID:9596 Length:488 Species:Homo sapiens


Alignment Length:444 Identity:101/444 - (22%)
Similarity:168/444 - (37%) Gaps:106/444 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 GGNSTSS-DPGEFDNLNSFYFYETEQFAVLWILFTVIVLGNSAVLFVMFINKNRKSRMNYFIKQL 165
            |.||::| .|   |.|||       ...:..::|...|:||...:.|:.  |:||.:     |:.
Human     5 GVNSSASLSP---DRLNS-------PVTIPAVMFIFGVVGNLVAIVVLC--KSRKEQ-----KET 52

  Fly   166 ALADLCVGLLNVLTDIIWRITIS-----------WRAGNLACKAIRFSQVCVTYSSTYVLVAMSI 219
            ....|..||  .:||::..:.:|           |..|...|:...|..:..:.|...::.|||:
Human    53 TFYTLVCGL--AVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSV 115

  Fly   220 DRYDAITHPMNFSKSWKRARHLV----AGAWLI-----SALF-SLPILVLYEEKLIQGHPQCWIE 274
            :||.||.|...:|       |.|    ||..|.     :.|| :||.:.|...:|......|:|:
Human   116 ERYLAINHAYFYS-------HYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFID 173

  Fly   275 LGSPIAWQVYMSLVSATLFAIPALIISACYAIIVKTIWAKGSIFVPTERAGFG-----AAPARRA 334
            ..:.:......|.:.|...:...|....|..::...:......|:  .|...|     ||.|...
Human   174 WTTNVTAHAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFM--RRTSLGTEQHHAAAAASV 236

  Fly   335 SSRG------IIPR---------------AKVKTVKMTLTIVFVFIICWSPYIIFDLLQVF-GQI 377
            :|||      .:||               |:::.|.:.:....|.:||..|.::    :|| .|:
Human   237 ASRGHPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVV----RVFVNQL 297

  Fly   378 --PHSQTNIAIATFIQS--LAPLNSAANPLIYCLFSSQVFRTLSR-FPPFKWFTC---------- 427
              |..:..::....:|:  :|.:|...:|.||.|....|   ||: ....|...|          
Human   298 YQPSLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTV---LSKAIEKIKCLFCRIGGSRRERS 359

  Fly   428 ---CCKSYRNNSQQNRCHT---VGRRLHNSCDSMRTLTTSLTVSRRSTNKTNAR 475
               |..|.|.:|..:. |:   :.|.|.....:.:||...|::...|.|....|
Human   360 GQHCSDSQRTSSAMSG-HSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGR 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCAP-RNP_001368957.1 7tmA_NPSR 124..416 CDD:320325 75/343 (22%)
TM helix 1 126..150 CDD:320325 5/23 (22%)
TM helix 2 159..182 CDD:320325 6/22 (27%)
TM helix 3 197..219 CDD:320325 4/21 (19%)
TM helix 4 240..256 CDD:320325 8/25 (32%)
TM helix 5 282..305 CDD:320325 4/22 (18%)
TM helix 6 348..370 CDD:320325 5/21 (24%)
TM helix 7 384..409 CDD:320325 7/26 (27%)
PTGER4NP_000949.1 7tmA_PGE2_EP4 18..341 CDD:320270 79/354 (22%)
TM helix 1 19..45 CDD:320270 6/34 (18%)
TM helix 2 54..80 CDD:320270 6/27 (22%)
TM helix 3 92..122 CDD:320270 9/29 (31%)
TM helix 4 134..156 CDD:320270 7/21 (33%)
TM helix 5 180..209 CDD:320270 4/28 (14%)
TM helix 6 265..295 CDD:320270 8/33 (24%)
TM helix 7 308..333 CDD:320270 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..376 4/20 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 437..475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.