DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCAP-R and Ptgdr

DIOPT Version :9

Sequence 1:NP_001368957.1 Gene:CCAP-R / 2768688 FlyBaseID:FBgn0039396 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_032988.3 Gene:Ptgdr / 19214 MGIID:102966 Length:357 Species:Mus musculus


Alignment Length:369 Identity:72/369 - (19%)
Similarity:139/369 - (37%) Gaps:102/369 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 ILFTVIVLGNSAVLFVMF---INKNRKSRMN-----YFIKQLALADLCVGLLNVLTDIIWRITIS 188
            :||...:|||...|.::.   :...|...::     :::       |..||  .:||::.:..||
Mouse    24 VLFGAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVFYV-------LVCGL--TVTDLLGKCLIS 79

  Fly   189 -----------------WRAGNLACKAIRFSQVCVTYSSTYVLVAMSIDRYDAITHPMNFSKSWK 236
                             ..:||..|:...|.......:||..|:||:::.:.::.||..:.    
Mouse    80 PMVLAAYAQNQSLKELLPASGNQLCETFAFLMSFFGLASTLQLLAMAVECWLSLGHPFFYQ---- 140

  Fly   237 RARHL----------VAGAWLISALFSLPILVLYEEKLIQGHPQCWIELG--------SPIAWQV 283
              ||:          |..|:.: |..:||....  .|.:|..|..|..:.        |.|.:.|
Mouse   141 --RHVTLRRGVLVAPVVAAFCL-AFCALPFAGF--GKFVQYCPGTWCFIQMIHKERSFSVIGFSV 200

  Fly   284 -YMSLVSATLFAIPALIISACYAIIVKTIWAKGSIF------------VPTERAGFGAAPARRAS 335
             |.||:        ||::   .|.:|..:.|..:::            ...:||..| :..|..|
Mouse   201 LYSSLM--------ALLV---LATVVCNLGAMYNLYDMHRRQRHYPHRCSRDRAQSG-SDYRHGS 253

  Fly   336 SRGIIPRAKVKTVKMTLTIVFVFIICWSPYI---IFDLLQVFGQIPHSQTNIAIATFIQSLAPLN 397
               :.|..::....:...:..:|.:|..|.|   .:...::..:......::....|:..:    
Mouse   254 ---LHPLEELDHFVLLALMTVLFTMCSLPLIYRAYYGAFKLENKAEGDSEDLQALRFLSVI---- 311

  Fly   398 SAANPLIYCLFSSQVFRTLSRFPPFKWFT--CCCKSYRNNSQQN 439
            |..:|.|:.:|.:.|||.|..    |.||  ...:::.::|||:
Mouse   312 SIVDPWIFIIFRTSVFRMLFH----KVFTRPLIYRNWSSHSQQS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCAP-RNP_001368957.1 7tmA_NPSR 124..416 CDD:320325 65/342 (19%)
TM helix 1 126..150 CDD:320325 6/20 (30%)
TM helix 2 159..182 CDD:320325 5/27 (19%)
TM helix 3 197..219 CDD:320325 6/21 (29%)
TM helix 4 240..256 CDD:320325 5/25 (20%)
TM helix 5 282..305 CDD:320325 6/23 (26%)
TM helix 6 348..370 CDD:320325 4/24 (17%)
TM helix 7 384..409 CDD:320325 4/24 (17%)
PtgdrNP_032988.3 7tm_1 58..318 CDD:278431 53/296 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.