| Sequence 1: | NP_001368957.1 | Gene: | CCAP-R / 2768688 | FlyBaseID: | FBgn0039396 | Length: | 521 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_506054.2 | Gene: | ZK863.1 / 191444 | WormBaseID: | WBGene00014122 | Length: | 370 | Species: | Caenorhabditis elegans |
| Alignment Length: | 311 | Identity: | 65/311 - (20%) |
|---|---|---|---|
| Similarity: | 105/311 - (33%) | Gaps: | 101/311 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 231 FSKSWKRARHLVAGAWLISALFSLPILVLYEEKLIQGHP-------QCWIELGSPIAWQVYMSL- 287
Fly 288 ----VSATLFAIPALIISACYAIIVKTIWAKGSIFVPTERAGFGAA-------PARRASSRGIIP 341
Fly 342 RAKVKTVKMTLTIVFVFIIC--WSPYIIFDLLQVFGQIPHSQTNIAIATFIQSLAPLNSAANPLI 404
Fly 405 YC----LFSSQ------VFRTLSRFPPF---------------KWFT----CCCKSYRNNSQQNR 440
Fly 441 CHTVGRRLHNSCDSMRTLTTSLTVSRRSTNKTNA--RVVICERPTKVVTVP 489 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CCAP-R | NP_001368957.1 | 7tmA_NPSR | 124..416 | CDD:320325 | 45/215 (21%) |
| TM helix 1 | 126..150 | CDD:320325 | |||
| TM helix 2 | 159..182 | CDD:320325 | |||
| TM helix 3 | 197..219 | CDD:320325 | |||
| TM helix 4 | 240..256 | CDD:320325 | 2/15 (13%) | ||
| TM helix 5 | 282..305 | CDD:320325 | 4/27 (15%) | ||
| TM helix 6 | 348..370 | CDD:320325 | 6/23 (26%) | ||
| TM helix 7 | 384..409 | CDD:320325 | 5/28 (18%) | ||
| ZK863.1 | NP_506054.2 | 7tm_GPCRs | 36..289 | CDD:391938 | 59/284 (21%) |
| TM helix 2 | 50..74 | CDD:341315 | 4/23 (17%) | ||
| TM helix 3 | 90..120 | CDD:341315 | 5/33 (15%) | ||
| TM helix 4 | 131..149 | CDD:341315 | 5/20 (25%) | ||
| TM helix 5 | 182..206 | CDD:341315 | 5/23 (22%) | ||
| TM helix 6 | 248..278 | CDD:341315 | 7/23 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24224 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||