DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCAP-R and srv-21

DIOPT Version :10

Sequence 1:NP_001368957.1 Gene:CCAP-R / 2768688 FlyBaseID:FBgn0039396 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_500880.1 Gene:srv-21 / 186686 WormBaseID:WBGene00005732 Length:317 Species:Caenorhabditis elegans


Alignment Length:136 Identity:38/136 - (27%)
Similarity:47/136 - (34%) Gaps:46/136 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   631 WQGALILKSSLFPAKFHLTDGDADIVDGLMKDEDGKHHLRITQRLRLDQPKL----EDVQK-RIS 690
            ||   |...||..||..|         ||.:           :.||:|...|    .:||. .:|
 Worm   270 WQ---INLESLVEAKLDL---------GLER-----------KVLRMDVTDLIIGIRNVQSLHLS 311

  Fly   691 TSSSHAIFL----GLPGSNPAVSSSDDASVQTRPLRNLVTYLKQKEA------------AGVISL 739
            ..|.|.|:.    |||.....|:.| ..|...|..|.|...|||...            .|.:|:
 Worm   312 PDSVHVIYSYCRHGLPVFKNLVNLS-FGSKNKRGWRLLANLLKQSTKLETLIVKDLNGYTGDVSM 375

  Fly   740 -LNKET 744
             |||.|
 Worm   376 PLNKVT 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCAP-RNP_001368957.1 7tmA_NPSR 124..416 CDD:320325
TM helix 1 125..151 CDD:320325
TM helix 2 158..185 CDD:320325
TM helix 3 196..226 CDD:320325
TM helix 4 237..258 CDD:320325
TM helix 5 281..310 CDD:320325
TM helix 6 342..372 CDD:320325
TM helix 7 384..409 CDD:320325
srv-21NP_500880.1 7TM_GPCR_Srv 26..307 CDD:370977 15/59 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.