Sequence 1: | NP_001368957.1 | Gene: | CCAP-R / 2768688 | FlyBaseID: | FBgn0039396 | Length: | 521 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_507676.1 | Gene: | C54E10.3 / 183793 | WormBaseID: | WBGene00008308 | Length: | 318 | Species: | Caenorhabditis elegans |
Alignment Length: | 241 | Identity: | 63/241 - (26%) |
---|---|---|---|
Similarity: | 99/241 - (41%) | Gaps: | 63/241 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 EFDNLNSFYFYETEQFAVLWI-LFTVIVLGNSAVLFVMFINKNRKSRMN-----YFIKQLA---- 166
Fly 167 -LADLCVGLLNVLTDIIWRITISWRAGNLACKAIRFSQVCVTYSSTYV---LVAMSIDRYDAITH 227
Fly 228 PMNFSKSWK-RARHLVAGAWLISALFSL--PILV-----------LY--EEKLIQGHPQCWIELG 276
Fly 277 SPIAWQVYMSLVSATLFAIPALIISACYAIIVKTIWAKGSIFVPTE 322 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CCAP-R | NP_001368957.1 | 7tmA_NPSR | 124..416 | CDD:320325 | 59/229 (26%) |
TM helix 1 | 126..150 | CDD:320325 | 5/24 (21%) | ||
TM helix 2 | 159..182 | CDD:320325 | 7/32 (22%) | ||
TM helix 3 | 197..219 | CDD:320325 | 9/24 (38%) | ||
TM helix 4 | 240..256 | CDD:320325 | 5/17 (29%) | ||
TM helix 5 | 282..305 | CDD:320325 | 6/22 (27%) | ||
TM helix 6 | 348..370 | CDD:320325 | |||
TM helix 7 | 384..409 | CDD:320325 | |||
C54E10.3 | NP_507676.1 | 7tm_GPCRs | <99..>247 | CDD:391938 | 43/155 (28%) |
TM helix 3 | 105..135 | CDD:341315 | 12/32 (38%) | ||
TM helix 4 | 147..169 | CDD:341315 | 7/21 (33%) | ||
TM helix 5 | 194..217 | CDD:341315 | 6/24 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24224 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |