DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LpR1 and lrx-1

DIOPT Version :9

Sequence 1:NP_001097934.2 Gene:LpR1 / 2768687 FlyBaseID:FBgn0066101 Length:1076 Species:Drosophila melanogaster
Sequence 2:NP_506072.2 Gene:lrx-1 / 192091 WormBaseID:WBGene00003075 Length:368 Species:Caenorhabditis elegans


Alignment Length:221 Identity:80/221 - (36%)
Similarity:102/221 - (46%) Gaps:29/221 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 CDEKQFQCHSGDCIPIRFVCDGDADCKDHSDEQ------IKECK--------FIEATCSSDQFRC 186
            |....|||..|...|:  .|..:....|.|.|.      ||.|.        .|:.||:.::|.|
 Worm   153 CSHVFFQCSIGQTFPL--ACMSEDQAFDKSTENCNHKNAIKFCPEYDHVMHCTIKDTCTENEFAC 215

  Fly   187 --GNGNCIPNKWRCDQESDCADGSDEANELCMNACPNNEFKCQTVDQCIPRSWLCDG-SNDCRDK 248
              ...:||....|||...|||||.||.|  | .:|..:||.|...:.|||.:..||| ::||.|.
 Worm   216 CAMPQSCIHVSKRCDGHPDCADGEDENN--C-PSCARDEFACVKSEHCIPANKRCDGVADDCEDG 277

  Fly   249 S--DEAHCRARTCSPDEYACKSGEG--QCVPLAWMCDQSKDCSDGSDEHNCNQTCRADEFTCGNG 309
            |  ||..|...|....::.|.:..|  .||.|...||..|||.:|.||.||.|..|.....|.|.
 Worm   278 SNLDEIGCSKNTTCIGKFVCGTSRGGVSCVDLDMHCDGKKDCLNGEDEMNCKQEGRQKYLLCENQ 342

  Fly   310 R--CIQKRWKCDHDDDCGDGSDEKEC 333
            :  ..:.:| |:.:.||.||||||.|
 Worm   343 KQSVTRLQW-CNGETDCADGSDEKYC 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LpR1NP_001097934.2 LDLa 135..167 CDD:197566 9/30 (30%)
LDLa 178..210 CDD:197566 14/33 (42%)
LDLa 219..254 CDD:238060 16/37 (43%)
LDLa 259..295 CDD:238060 13/37 (35%)
LDLa 343..373 CDD:238060
LDLa 383..415 CDD:197566
Ldl_recept_a 423..459 CDD:278486
LDLa 476..504 CDD:197566
FXa_inhibition 514..549 CDD:291342
EGF_CA 551..581 CDD:214542
LY 662..702 CDD:214531
LY 704..747 CDD:214531
LY 749..790 CDD:214531
FXa_inhibition 864..905 CDD:291342
lrx-1NP_506072.2 LDLa 208..244 CDD:238060 16/37 (43%)
LDLa 247..285 CDD:238060 16/37 (43%)
LDLa 293..328 CDD:238060 13/34 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.