DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and ZNF606

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_001334951.1 Gene:ZNF606 / 80095 HGNCID:25879 Length:792 Species:Homo sapiens


Alignment Length:940 Identity:164/940 - (17%)
Similarity:284/940 - (30%) Gaps:379/940 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly  1014 ISSPQVQSQIELQMEPQIETQMQPQ---------IETRMQHDVLSV-QSPQNHQPQVQSH----- 1063
            |:.|:|.|.:|...||....|..||         :|::......|: :..|:|..:::.:     
Human   105 IAKPEVISLLEQGEEPWSVEQACPQRTCPEWVRNLESKALIPAQSIFEEEQSHGMKLERYIWDDP 169

  Fly  1064 -----------DQSQMQHQIPPQIEPQIEVQNQEQNTLQLVPQAQHQVVPHVQLQSQLVPHVQTQ 1117
                       ||.:|.|            .||                                
Human   170 WFSRLEVLGCKDQLEMYH------------MNQ-------------------------------- 190

  Fly  1118 GTTTTVTYEQIYQQHIVQQTVQQSSNKMQVISLPSAGSETTRQWQTQQSQQQQQVQ--------- 1173
               :|...:.::.|   :|.:.|.|::     ....|:|.::......||:..|::         
Human   191 ---STAMRQMVFMQ---KQVLSQRSSE-----FCGLGAEFSQNLNFVPSQRVSQIEHFYKPDTHA 244

  Fly  1174 --WSSVGGLEAIKSAPVESVAPTTTTYYISASDLYPQQTET----YTMLQPASNESYVIEQVNHQ 1232
              |.....:........|: .....|.|.|...:||.:.:|    :.......:.:::|...:|:
Human   245 QSWRCDSAIMYADKVTCEN-NDYDKTVYQSIQPIYPARIQTGDNLFKCTDAVKSFNHIIHFGDHK 308

  Fly  1233 QQHCQQQIQMSQQQHQRQHQQQQAQQQQQPIMILIQQPEIQQPVASASNPQQAPLHI----YNAA 1293
            ..|..:::...::.||                |..|.|...:      :|:   ||:    ||..
Human   309 GIHTGEKLYEYKECHQ----------------IFNQSPSFNE------HPR---LHVGENQYNYK 348

  Fly  1294 TSNDVHQ----MQHTQRQQIRQQYQHQQYQRLQQPQQTRVVQSHPVLGMPGATSISTKVTPIPVT 1354
            ...::..    |:|.:...:.:.|::.:::::.                 |..|..|:.|.   |
Human   349 EYENIFYFSSFMEHQKIGTVEKAYKYNEWEKVF-----------------GYDSFLTQHTS---T 393

  Fly  1355 AARGRPLTLKCRFCHNGPRFSSSLEYSRHIID---LHPAVAPFNCPHCPMAFAGRTKRSQHILSH 1416
            ....:|      :.:|  ...:|..:|.::|.   .|....|:.|..|...|..|:..::|..:|
Human   394 YTAEKP------YDYN--ECGTSFIWSSYLIQHKKTHTGEKPYECDKCGKVFRNRSALTKHERTH 450

  Fly  1417 HVVQQYQCGQCSHVFPAQKALDVHIQRFHMTLKTDPSGAVKVEDVQLQITSER----RPRGRPYK 1477
            ..::.|:|.:|...|.....|.|| :|.|                    |.|:    ...|:.:.
Human   451 TGIKPYECNKCGKAFSWNSHLIVH-KRIH--------------------TGEKPYVCNECGKSFN 494

  Fly  1478 PRLQLQQHQLQPQQKLQVQQHQQQQKALQQLPQAQHHQQQQQPQLQQEVLQQVQQLQVQVQPQQH 1542
            ....|..||                                                        
Human   495 WNSHLIGHQ-------------------------------------------------------- 503

  Fly  1543 QQHQQVLQVQQPQQQPLMQPQSPHPSTVEMQASPTTPRKILCCPDCEDCTSGHSHANEQFEELQT 1607
            :.|                                |..|...|.:|....|..||          
Human   504 RTH--------------------------------TGEKPFECTECGKSFSWSSH---------- 526

  Fly  1608 LQAPPTVLTPPSTIVSVPSPQPMVYSQHITMPSPEQSEP----DSTTTLRQYRKRGVIVGPQGPL 1668
                         :::           |:.|.:.|  :|    :.....|.|             
Human   527 -------------LIA-----------HMRMHTGE--KPFKCDECEKAFRDY------------- 552

  Fly  1669 HLATPVASPSPSSSPSSSTVDHIPPASPATPASPAPPPSPAVASTVQVSELRTSHHCLYCEERFT 1733
                            |:...|....|.|.|                       :.|..|.:.|:
Human   553 ----------------SALSKHERTHSGAKP-----------------------YKCTECGKSFS 578

  Fly  1734 NEISLKKHHQLAHGALTT--MPYVCTICKRGYRMRTALHRHMESHDVEG-RPYECNICRVRFPRP 1795
                 ...|.:||....|  .||.|..|.:.:|.|:||.:|...|  .| :|||||.|.....:.
Human   579 -----WSSHLIAHQRTHTGEKPYNCQECGKAFRERSALTKHEIIH--SGIKPYECNKCGKSCSQM 636

  Fly  1796 SQLTLHKITVHLLSKPHTCDECGKQFGTESALKTHIKFH-GELGYQCDGCDRTFEYLKELRKHRR 1859
            :.|..|:.| |...||:.|::|||.|.....|..|.:.| ||..|:|:.|:|:|.....|..|||
Human   637 AHLVRHQRT-HTGEKPYECNKCGKSFSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRR 700

  Fly  1860 THS-EMFYKCKFCPSSFMRFTNFRAHMKTH 1888
            ||: |..|:|..|..:|...::...|::.|
Human   701 THTGEKPYRCNECGKAFNESSSLIVHLRNH 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368 4/25 (16%)
C2H2 Zn finger 1396..1416 CDD:275368 5/19 (26%)
C2H2 Zn finger 1424..1445 CDD:275368 7/20 (35%)
C2H2 Zn finger 1725..1746 CDD:275368 4/20 (20%)
C2H2 Zn finger 1756..1776 CDD:275368 7/19 (37%)
C2H2 Zn finger 1785..1806 CDD:275368 6/20 (30%)
C2H2 Zn finger 1814..1834 CDD:275368 7/19 (37%)
zf-C2H2 1839..1861 CDD:278523 9/21 (43%)
C2H2 Zn finger 1841..1861 CDD:275368 8/19 (42%)
C2H2 Zn finger 1868..1888 CDD:275368 4/19 (21%)
ZNF606NP_001334951.1 KRAB 62..122 CDD:214630 7/16 (44%)
C2H2 Zn finger 291..311 CDD:275368 2/19 (11%)
C2H2 Zn finger 319..339 CDD:275368 6/44 (14%)
COG5048 383..774 CDD:227381 109/564 (19%)
C2H2 Zn finger 403..422 CDD:275368 4/20 (20%)
C2H2 Zn finger 430..450 CDD:275368 5/19 (26%)
C2H2 Zn finger 458..478 CDD:275368 7/20 (35%)
C2H2 Zn finger 486..506 CDD:275368 4/75 (5%)
C2H2 Zn finger 514..534 CDD:275368 6/53 (11%)
C2H2 Zn finger 542..562 CDD:275368 4/48 (8%)
C2H2 Zn finger 570..590 CDD:275368 6/24 (25%)
C2H2 Zn finger 598..618 CDD:275368 7/19 (37%)
C2H2 Zn finger 626..646 CDD:275368 6/20 (30%)
C2H2 Zn finger 654..674 CDD:275368 7/19 (37%)
C2H2 Zn finger 682..702 CDD:275368 8/19 (42%)
C2H2 Zn finger 710..730 CDD:275368 4/19 (21%)
C2H2 Zn finger 738..758 CDD:275368
C2H2 Zn finger 766..786 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24376
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.