DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and ZNF665

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_001340387.1 Gene:ZNF665 / 79788 HGNCID:25885 Length:706 Species:Homo sapiens


Alignment Length:687 Identity:132/687 - (19%)
Similarity:227/687 - (33%) Gaps:205/687 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1234 QHCQQQIQMSQQQHQRQHQQQQAQQQQQPIMILIQQPEIQQPVASASNPQQAPLHIYNAATSNDV 1298
            :|.:.|:.:|.|.|                     .||:||      ...:..::.||....:..
Human   163 RHIENQLGVSFQSH---------------------LPELQQ------FQHEGKIYEYNQVEKSPN 200

  Fly  1299 HQMQHTQRQQIRQQY-------QHQQYQRLQQPQQTRVVQSHPVLGMPGATSISTKVTPIPVTAA 1356
            ::.:|.:..:..:.:       .|::....::|.|......        |.::.:.:|...|...
Human   201 NRGKHYKCDECGKVFSQNSRLTSHKRIHTGEKPYQCNKCGK--------AFTVRSNLTIHQVIHT 257

  Fly  1357 RGRPLTLKCRFCHNGPRFSSSLEYSRHIIDLHPAVAPFNCPHCPMAFAGRTKRSQHILSHHVVQQ 1421
            ..:|  .||..|  |..||.....:.| ..:|....|:.|..|..||...:|.:.|.:.|...:.
Human   258 GEKP--YKCNEC--GKVFSQPSNLAGH-QRIHTGEKPYKCNECGKAFRAHSKLTTHQVIHTGEKP 317

  Fly  1422 YQCGQCSHVFPAQKALDVHIQRFHMTLKTDPSGAVKVEDVQLQITSERRPR----GRPYKPRLQL 1482
            |:|.:|...|.....|..| :|.|                    |.|:..:    |:.:..|..|
Human   318 YKCKECGKCFTQNSHLASH-RRIH--------------------TGEKPYKCNECGKAFSVRSSL 361

  Fly  1483 QQHQLQPQQKLQVQQHQQQQKALQQLPQAQHHQQQQQPQLQQEVLQQVQQLQVQVQPQQHQQHQQ 1547
            ..||       .:...::..|..:.....:|:...                         .:|::
Human   362 TTHQ-------TIHTGEKPYKCNECGKVFRHNSYL-------------------------AKHRR 394

  Fly  1548 VLQVQQPQQ-QPLMQPQSPHPSTVEMQASPTTPRKILCCPDCEDCTSGHSH-ANEQFEELQTLQA 1610
            :...::|.: ....:..|.|.:..:.|.. .|..|...|.:|....:.:|| ||.:  .:.|.:.
Human   395 IHTGEKPYKCNECGKAFSMHSNLTKHQII-HTGEKPFKCNECVKVFTQYSHLANHR--RIHTGEK 456

  Fly  1611 P------------PTVLTPPSTIVSVPSPQP-----MVYSQHITMPSPEQSEPDSTTTLRQYRKR 1658
            |            .:.||....|.:...|..     .|::|:..:.|                .|
Human   457 PYRCDECGKAFSVRSSLTTHQAIHTGEKPYKCNDCGKVFTQNSHLAS----------------HR 505

  Fly  1659 GVIVGPQGPLHLATPVASPSPSSSPSSSTVDHIPPASPATPASPAPPPSPAVASTVQVSELRTSH 1723
            |:..|.:                                                        .:
Human   506 GIHSGEK--------------------------------------------------------PY 514

  Fly  1724 HCLYCEERFTNEISLKKHHQLAHGALTTMPYVCTICKRGYRMRTALHRHMESHDVEGRPYECNIC 1788
            .|..|.:.|:....|.:|.::..|   ..||.|..|.:.:.:.::|..|...|..: :||:||.|
Human   515 KCDECGKAFSQTSQLARHWRVHTG---EKPYKCNECGKAFSVHSSLTIHQTIHTGQ-KPYKCNDC 575

  Fly  1789 RVRFPRPSQLTLHKITVHLLSKPHTCDECGKQFGTESALKTHIKFH-GELGYQCDGCDRTFEYLK 1852
            ...|...|.|.:|: .:|...||:.|:||||.|...|.|.||...| ||..|:|:.|.:.|....
Human   576 GKVFRHNSYLAIHQ-RIHTGEKPYKCNECGKAFSVHSNLATHQVIHTGEKPYKCNECGKVFTQNS 639

  Fly  1853 ELRKHRRTHS-EMFYKCKFCPSSFMRFTNFRAHMKTH 1888
            .|..|||.|: |..|:|..|..:|...:....||..|
Human   640 HLANHRRIHTGEKPYRCNECGKAFSVRSTLTTHMAVH 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368 6/22 (27%)
C2H2 Zn finger 1396..1416 CDD:275368 6/19 (32%)
C2H2 Zn finger 1424..1445 CDD:275368 6/20 (30%)
C2H2 Zn finger 1725..1746 CDD:275368 5/20 (25%)
C2H2 Zn finger 1756..1776 CDD:275368 4/19 (21%)
C2H2 Zn finger 1785..1806 CDD:275368 7/20 (35%)
C2H2 Zn finger 1814..1834 CDD:275368 10/19 (53%)
zf-C2H2 1839..1861 CDD:278523 8/21 (38%)
C2H2 Zn finger 1841..1861 CDD:275368 7/19 (37%)
C2H2 Zn finger 1868..1888 CDD:275368 5/19 (26%)
ZNF665NP_001340387.1 KRAB 37..76 CDD:307490
COG5048 192..580 CDD:227381 86/532 (16%)
C2H2 Zn finger 208..228 CDD:275368 1/19 (5%)
C2H2 Zn finger 236..256 CDD:275368 3/27 (11%)
C2H2 Zn finger 264..284 CDD:275368 6/22 (27%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)
C2H2 Zn finger 320..340 CDD:275368 6/20 (30%)
C2H2 Zn finger 348..368 CDD:275368 5/26 (19%)
C2H2 Zn finger 376..396 CDD:275368 2/44 (5%)
C2H2 Zn finger 404..424 CDD:275368 3/20 (15%)
C2H2 Zn finger 432..452 CDD:275368 6/21 (29%)
C2H2 Zn finger 460..480 CDD:275368 2/19 (11%)
C2H2 Zn finger 488..508 CDD:275368 5/35 (14%)
C2H2 Zn finger 516..536 CDD:275368 5/19 (26%)
C2H2 Zn finger 544..564 CDD:275368 4/19 (21%)
C2H2 Zn finger 572..592 CDD:275368 7/20 (35%)
zf-H2C2_2 584..608 CDD:316026 10/24 (42%)
C2H2 Zn finger 600..620 CDD:275368 10/19 (53%)
zf-H2C2_2 612..637 CDD:316026 10/24 (42%)
C2H2 Zn finger 628..648 CDD:275368 7/19 (37%)
zf-H2C2_2 640..664 CDD:316026 9/23 (39%)
C2H2 Zn finger 656..676 CDD:275368 5/19 (26%)
zf-H2C2_2 669..693 CDD:316026 3/8 (38%)
C2H2 Zn finger 684..704 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.