DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and ZNF225

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_001308614.1 Gene:ZNF225 / 7768 HGNCID:13018 Length:706 Species:Homo sapiens


Alignment Length:856 Identity:155/856 - (18%)
Similarity:257/856 - (30%) Gaps:315/856 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1087 QNTLQLVPQAQHQVVPH-------------VQLQSQLVPHVQTQGTTTTV--TYEQIYQQHIVQQ 1136
            :|.|.:..|:.|:...|             .|.:..|...:|.:..|.:.  |:|.::.    .|
Human    42 RNLLSVGHQSLHRDTFHFLKEEKFWMMETATQREGNLGGKIQMEMETVSESGTHEGLFS----HQ 102

  Fly  1137 TVQQSSNKMQVISLPSAGSETTRQWQTQ----QSQQQQQVQWSSVGGLEAI--KSAPVESVAPTT 1195
            |.:|.|            |:.||...:.    |..:|..:......||..|  :..|.|......
Human   103 TWEQIS------------SDLTRFQDSMVNSFQFSKQDDMPCQVDAGLSIIHVRQKPSEGRTCKK 155

  Fly  1196 TTYYISASDLYPQQTETYTMLQPASNESYVIEQVNHQQQHCQQQIQMSQ--QQHQRQHQQQQAQQ 1258
            :...:|..||:.|       ||  |.|.      :|....|.:....|.  :.|||.|..::...
Human   156 SFSDVSVLDLHQQ-------LQ--SREK------SHTCDECGKSFCYSSALRIHQRVHMGEKLYN 205

  Fly  1259 QQQPIMILIQQPEIQQPVASASNPQQAPLHIYNAATSNDVHQMQHTQRQQIRQQYQHQQYQRLQQ 1323
                              ......:      :|.::...:||..||..:..:.:...:.:.|.. 
Human   206 ------------------CDVCGKE------FNQSSHLQIHQRIHTGEKPFKCEQCGKGFSRRS- 245

  Fly  1324 PQQTRVVQSHPVLGMPGATSISTKVTPIPVTAARGRPLTLKC--RFCHNGPRFSSSLEYSRHIID 1386
                         |:.....:.|.|.|         .:..||  .|.|:    |...|:.|    
Human   246 -------------GLYVHRKLHTGVKP---------HICEKCGKAFIHD----SQLQEHQR---- 280

  Fly  1387 LHPAVAPFNCPHCPMAFAGRTKRSQHILSHHVVQQYQCGQCSHVFPAQKALDVHIQRFHMTLKTD 1451
            :|....||.|..|..:|..|...::|.:.|...:.::|..|...|..:.||:.|           
Human   281 IHTGEKPFKCDICCKSFRSRANLNRHSMVHMREKPFRCDTCGKSFGLKSALNSH----------- 334

  Fly  1452 PSGAVKVEDVQLQITSERRPR----GRPYKPRLQLQQHQLQPQQKLQVQQHQQQQKALQQLPQAQ 1512
                      ::..|.|:|.:    |:.:..|..|.:||:.                        
Human   335 ----------RMVHTGEKRYKCEECGKRFIYRQDLYKHQID------------------------ 365

  Fly  1513 HHQQQQQPQLQQEVLQQVQQLQVQVQPQQHQQHQQVLQVQQPQQQPLMQPQSPHPSTVEMQASPT 1577
             |..::                                              |:           
Human   366 -HTGEK----------------------------------------------PY----------- 372

  Fly  1578 TPRKILCCPDCEDCTSGHSHANEQFEELQTLQAPPTVLTPPSTIVSVPSPQPMVYSQHITMPSPE 1642
                     :|::|......|:.                               .|:|:.:.|.|
Human   373 ---------NCKECGKSFRWASG-------------------------------LSRHVRVHSGE 397

  Fly  1643 QSEPDSTTTLRQYRKRGVIVGPQGPLHLATPVASPSPSSSPSSSTVDHIPPASPATPASPAPPPS 1707
                  ||...:...:|...                     :|....|....|...|        
Human   398 ------TTFKCEECGKGFYT---------------------NSQRYSHQRAHSGEKP-------- 427

  Fly  1708 PAVASTVQVSELRTSHHCLYCEERFTNEISLKKHHQLAHGALTTMPYVCTICKRGYRMRTALHRH 1772
                           :.|..|.:.:...:.|..|.::..|   ..||.|..|.:.:...:.|..|
Human   428 ---------------YRCEECGKGYKRRLDLDFHQRVHRG---EKPYNCKECGKSFGWASCLLNH 474

  Fly  1773 MESHDVEGRPYECNICRVRFPRPSQLTLHKITVHLLSKPHTCDECGKQFGTESALKTHIKFH-GE 1836
            ...|..| :|::|..|..||.:.|||..|: .||...||..|:||||:|...|.|.:|.:.| |.
Human   475 QRIHSGE-KPFKCEECGKRFTQNSQLYTHR-RVHSGEKPFKCEECGKRFTQNSQLYSHRRVHTGV 537

  Fly  1837 LGYQCDGCDRTFEYLKELRKHRRTHS-EMFYKCKFCPSSFMRFTNFRAHMKTHLPLGVFRNEDAA 1900
            ..|:|:.|.:.|.....|..|:|.|: |..|.||.|..||.|.::...|.:.|.....|:.|:..
Human   538 KPYKCEECGKGFNSKFNLDMHQRVHTGERPYNCKECGKSFSRASSILNHKRLHGDEKPFKCEECG 602

  Fly  1901 SKSPSNNNSHA 1911
            .:...|:..|:
Human   603 KRFTENSQLHS 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368 6/24 (25%)
C2H2 Zn finger 1396..1416 CDD:275368 5/19 (26%)
C2H2 Zn finger 1424..1445 CDD:275368 6/20 (30%)
C2H2 Zn finger 1725..1746 CDD:275368 4/20 (20%)
C2H2 Zn finger 1756..1776 CDD:275368 4/19 (21%)
C2H2 Zn finger 1785..1806 CDD:275368 8/20 (40%)
C2H2 Zn finger 1814..1834 CDD:275368 9/19 (47%)
zf-C2H2 1839..1861 CDD:278523 7/21 (33%)
C2H2 Zn finger 1841..1861 CDD:275368 6/19 (32%)
C2H2 Zn finger 1868..1888 CDD:275368 7/19 (37%)
ZNF225NP_001308614.1 KRAB 8..48 CDD:307490 2/5 (40%)
C2H2 Zn finger 153..170 CDD:275368 4/23 (17%)
C2H2 Zn finger 178..198 CDD:275368 5/19 (26%)
COG5048 202..634 CDD:227381 115/665 (17%)
C2H2 Zn finger 206..226 CDD:275368 3/25 (12%)
C2H2 Zn finger 234..254 CDD:275368 2/33 (6%)
C2H2 Zn finger 262..282 CDD:275368 7/27 (26%)
C2H2 Zn finger 290..310 CDD:275368 5/19 (26%)
C2H2 Zn finger 318..338 CDD:275368 6/40 (15%)
C2H2 Zn finger 346..366 CDD:275368 5/44 (11%)
C2H2 Zn finger 374..394 CDD:275368 5/50 (10%)
C2H2 Zn finger 402..422 CDD:275368 3/40 (8%)
C2H2 Zn finger 430..450 CDD:275368 4/19 (21%)
C2H2 Zn finger 458..478 CDD:275368 4/19 (21%)
C2H2 Zn finger 486..506 CDD:275368 8/20 (40%)
C2H2 Zn finger 514..534 CDD:275368 9/19 (47%)
C2H2 Zn finger 542..562 CDD:275368 6/19 (32%)
C2H2 Zn finger 570..590 CDD:275368 7/19 (37%)
C2H2 Zn finger 598..618 CDD:275368 3/16 (19%)
C2H2 Zn finger 626..646 CDD:275368
C2H2 Zn finger 654..672 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24376
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.