| Sequence 1: | NP_001247289.1 | Gene: | mld / 2768685 | FlyBaseID: | FBgn0263490 | Length: | 1965 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_081275.3 | Gene: | Zfp688 / 69234 | MGIID: | 1916484 | Length: | 274 | Species: | Mus musculus |
| Alignment Length: | 203 | Identity: | 45/203 - (22%) |
|---|---|---|---|
| Similarity: | 68/203 - (33%) | Gaps: | 67/203 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 1625 PSPQPMVYS---QHITMPSPEQSEPDSTTTLRQYRKRGVIVGPQGPLHLAT----PVASPSPSSS 1682
Fly 1683 PS----SSTVDHIPPASPATPASPAPPPSPA-------------VAST-VQVSELRTSHHCLYCE 1729
Fly 1730 ERFTNEISLKKHHQLAHGALTTMPYVCTICKRGYRMRTALHRHMESHDVEGRPYECNICRVRFPR 1794
Fly 1795 PSQLTLHK 1802 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| mld | NP_001247289.1 | zf-AD | 186..255 | CDD:214871 | |
| C2H2 Zn finger | 1365..1388 | CDD:275368 | |||
| C2H2 Zn finger | 1396..1416 | CDD:275368 | |||
| C2H2 Zn finger | 1424..1445 | CDD:275368 | |||
| C2H2 Zn finger | 1725..1746 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 1756..1776 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 1785..1806 | CDD:275368 | 7/18 (39%) | ||
| C2H2 Zn finger | 1814..1834 | CDD:275368 | |||
| zf-C2H2 | 1839..1861 | CDD:278523 | |||
| C2H2 Zn finger | 1841..1861 | CDD:275368 | |||
| C2H2 Zn finger | 1868..1888 | CDD:275368 | |||
| Zfp688 | NP_081275.3 | KRAB | 26..86 | CDD:214630 | 5/17 (29%) |
| KRAB | 26..65 | CDD:279668 | |||
| COG5048 | <166..>233 | CDD:227381 | 25/97 (26%) | ||
| zf-C2H2 | 181..203 | CDD:278523 | 9/50 (18%) | ||
| C2H2 Zn finger | 183..203 | CDD:275368 | 8/48 (17%) | ||
| zf-H2C2_2 | 196..220 | CDD:290200 | 11/26 (42%) | ||
| C2H2 Zn finger | 211..231 | CDD:275368 | 7/18 (39%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167832268 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||