DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and ZNF302

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:XP_016882467.1 Gene:ZNF302 / 55900 HGNCID:13848 Length:444 Species:Homo sapiens


Alignment Length:148 Identity:52/148 - (35%)
Similarity:76/148 - (51%) Gaps:12/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1751 TMP--------YVCTICKRGYRMRTALHRHMESHDVEGRPYECNICRVRFPRPSQLTLHKITVHL 1807
            |:|        |.|:.|.:.:..::.|.||...|..| :||||..|...|...|.||.|:|: |.
Human   235 TLPQTCNREKIYTCSECGKAFGKQSILSRHWRIHTGE-KPYECRECGKTFSHGSSLTRHQIS-HS 297

  Fly  1808 LSKPHTCDECGKQFGTESALKTHIKFH-GELGYQCDGCDRTFEYLKELRKHRRTHS-EMFYKCKF 1870
            ..||:.|.||||.|...|:|..|...| ||..|:|..|.::|..:..|.:|.|.|: |..|:|:.
Human   298 GEKPYKCIECGKAFSHGSSLTNHQSTHTGEKPYECMNCGKSFSRVSLLIQHLRIHTQEKRYECRI 362

  Fly  1871 CPSSFMRFTNFRAHMKTH 1888
            |..:|:..::...|.|:|
Human   363 CGKAFIHSSSLIHHQKSH 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368
C2H2 Zn finger 1756..1776 CDD:275368 5/19 (26%)
C2H2 Zn finger 1785..1806 CDD:275368 8/20 (40%)
C2H2 Zn finger 1814..1834 CDD:275368 9/19 (47%)
zf-C2H2 1839..1861 CDD:278523 7/21 (33%)
C2H2 Zn finger 1841..1861 CDD:275368 6/19 (32%)
C2H2 Zn finger 1868..1888 CDD:275368 5/19 (26%)
ZNF302XP_016882467.1 KRAB 48..109 CDD:214630
COG5048 <151..393 CDD:227381 52/148 (35%)
C2H2 Zn finger 248..268 CDD:275368 5/19 (26%)
C2H2 Zn finger 276..296 CDD:275368 8/20 (40%)
C2H2 Zn finger 304..324 CDD:275368 9/19 (47%)
C2H2 Zn finger 332..352 CDD:275368 6/19 (32%)
C2H2 Zn finger 360..380 CDD:275368 5/19 (26%)
C2H2 Zn finger 388..408 CDD:275368
C2H2 Zn finger 416..436 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.