DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and ZNF770

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_054825.2 Gene:ZNF770 / 54989 HGNCID:26061 Length:691 Species:Homo sapiens


Alignment Length:770 Identity:135/770 - (17%)
Similarity:222/770 - (28%) Gaps:284/770 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  1271 EIQQPVASASNPQQAP---------------------LHIYNAATSNDV-----HQMQHTQRQQI 1309
            :|||.|.:...|:..|                     :|........||     .|:.|.:|.|:
Human    11 KIQQCVVANKLPRNRPYVCNICFKHFETPSKLARHYLIHTGQKPFECDVCHKTFRQLVHLERHQL 75

  Fly  1310 -----------------------RQQYQHQQYQRLQQPQQTRVVQSHPVLGMPGATSIST----- 1346
                                   .||..::.||. ...|..|::::.....|.|..:..|     
Human    76 THSLPFKCSICQRHFKNLKTFVKHQQLHNETYQN-NVKQVRRLLEAKQEKSMYGVYNTFTTEERW 139

  Fly  1347 KVTPI----PVTAARGRPLTLKCRFCHNGPRFSSSLEYSRHIIDLHPAVAPFNCPHCPMAFAGRT 1407
            .:.|.    |:.:.:.|.....|..|  |..|.|..:..||:: :|....||.|..|..:|...|
Human   140 ALHPCSKSDPMYSMKRRKNIHACTIC--GKMFPSQSKLDRHVL-IHTGQRPFKCVLCTKSFRQST 201

  Fly  1408 KRSQHILSHHVVQQYQCGQCSHVFPAQKALDVHIQRFHMTLKTDPSGAVKVEDVQLQITSERRPR 1472
            ....|.|:|...:.:||..|...|..|..|..| ::.|...|.          .:..:..:||..
Human   202 HLKIHQLTHSEERPFQCCFCQKGFKIQSKLLKH-KQIHTRNKA----------FRALLLKKRRTE 255

  Fly  1473 GRPYKPRLQLQQHQLQPQQKLQVQQHQQQQKALQQLPQAQHHQQQQQPQLQQEVLQQVQQLQVQV 1537
            .||...:|...|...:..:..:.:::.         |...|                    .:.:
Human   256 SRPLPNKLNANQGGFENGEIGESEENN---------PLDVH--------------------SIYI 291

  Fly  1538 QPQQHQQHQQVLQVQQPQQQPLMQPQSPHPSTVEMQASPTTPRKILCCPDCEDCTSGHSHANE-- 1600
            .|.|                                           ||.||.|.......||  
Human   292 VPFQ-------------------------------------------CPKCEKCFESEQILNEHS 313

  Fly  1601 ---------------------------------QFEELQTLQAPPTVLTPPSTIVSVPSPQPMVY 1632
                                             :.::|...|:...|....             :
Human   314 CFAARSGKIPSRFKRSYNYKTIVKKILAKLKRARSKKLDNFQSEKKVFKKS-------------F 365

  Fly  1633 SQHITMPSPEQ-SEPDSTTTLRQYRKRGV--IVGPQGPLHLATPVASPSPSSS----PSSSTVDH 1690
            .::..:.|.|| ||....|.:....|.|.  .:|.:....|..|.:..:...:    .::..:..
Human   366 LRNCDLISGEQSSEQTQRTFVGSLGKHGTYKTIGNRKKKTLTLPFSWQNMGKNLKGILTTENILS 430

  Fly  1691 IPPASPATPASPAPPPSPAVASTVQV---------SELRTSHH---CLYCEERFTNEISLKKHHQ 1743
            |..:......|..........:..:|         ..:||.|.   |..||:.|.:...||:|:.
Human   431 IDNSVNKKDLSICGSSGEEFFNNCEVLQCGFSVPRENIRTRHKICPCDKCEKVFPSISKLKRHYL 495

  Fly  1744 LAHGALTTMPYVCTICKRGYRMRTALHRHMESHDVEGRPYECNICRVRFPRPSQLTLH------- 1801
            :..|   ..|:.|.||.:.:|....|.||.::|: |..|| .::|:|.|...:.|:.|       
Human   496 IHTG---QRPFGCNICGKSFRQSAHLKRHEQTHN-EKSPY-ASLCQVEFGNFNNLSNHSGNNVNY 555

  Fly  1802 ------------KITVH----------------------------LL----SKP----------- 1811
                        |..|.                            ||    |.|           
Human   556 NASQQCQAPGVQKYEVSESDQMSGVKAESQDFIPGSTGQPCLPNVLLESEQSNPFCSYSEHQEKN 620

  Fly  1812 ----HTCDECGKQFGTESALKTHIKFH-GELGYQCDGCDRTFEYLKELRKHRRTH 1861
                :.|..|.|.|.:.|.|:.|...| |:..::|..|.:||......::|:.||
Human   621 DVFLYRCSVCAKSFRSPSKLERHYLIHAGQKPFECSVCGKTFRQAPHWKRHQLTH 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368 7/22 (32%)
C2H2 Zn finger 1396..1416 CDD:275368 6/19 (32%)
C2H2 Zn finger 1424..1445 CDD:275368 6/20 (30%)
C2H2 Zn finger 1725..1746 CDD:275368 7/20 (35%)
C2H2 Zn finger 1756..1776 CDD:275368 7/19 (37%)
C2H2 Zn finger 1785..1806 CDD:275368 6/39 (15%)
C2H2 Zn finger 1814..1834 CDD:275368 7/19 (37%)
zf-C2H2 1839..1861 CDD:278523 5/21 (24%)
C2H2 Zn finger 1841..1861 CDD:275368 5/19 (26%)
C2H2 Zn finger 1868..1888 CDD:275368
ZNF770NP_054825.2 C2H2 Zn finger 29..49 CDD:275368 0/19 (0%)
zf-H2C2_2 42..66 CDD:316026 3/23 (13%)
C2H2 Zn finger 57..77 CDD:275368 6/19 (32%)
C2H2 Zn finger 83..103 CDD:275368 2/19 (11%)
C2H2 Zn finger 162..182 CDD:275368 7/22 (32%)
COG5048 185..530 CDD:227381 73/444 (16%)
C2H2 Zn finger 190..210 CDD:275368 6/19 (32%)
C2H2 Zn finger 218..238 CDD:275368 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..277 3/18 (17%)
C2H2 Zn finger 477..497 CDD:275368 7/19 (37%)
C2H2 Zn finger 505..525 CDD:275368 7/19 (37%)
C2H2 Zn finger 627..647 CDD:275368 7/19 (37%)
C2H2 Zn finger 655..675 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24376
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.