DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and Sry-delta

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_524581.1 Gene:Sry-delta / 43572 FlyBaseID:FBgn0003512 Length:433 Species:Drosophila melanogaster


Alignment Length:213 Identity:62/213 - (29%)
Similarity:87/213 - (40%) Gaps:16/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1720 RTSHHCLYCEERFTNEISLKKHHQLAHGALTTMP-YVCTICKRGYRMRTALHRHMESHDVEGR-P 1782
            |....|..|.:.:.:...|:||....|   :..| ::|.||....|....|..||..|  ||: .
  Fly   191 RVKQECTTCGKVYNSWYQLQKHISEEH---SKQPNHICPICGVIRRDEEYLELHMNLH--EGKTE 250

  Fly  1783 YECNICRVRFPRPSQLTLHKITVHLLSKPHTCDECGKQFGTESALKTHIKFH--GELGYQCDGCD 1845
            .:|..|...|.||.. ||..:.:|...|.:.|::||.:|..::.|..|...|  .|....|..|:
  Fly   251 KQCRYCPKSFSRPVN-TLRHMRMHWDKKKYQCEKCGLRFSQDNLLYNHRLRHEAEENPIICSICN 314

  Fly  1846 RTFEYLKELRKHRRTHSE--MFYKCKFCPSSFMRFTNFRAHMKTH---LPLGVFRNEDAASKSPS 1905
            .:|:..|....|...|.|  ..:.|..||.||......:.|||||   :..|| |.|..|.:...
  Fly   315 VSFKSRKTFNHHTLIHKENRPRHYCSVCPKSFTERYTLKMHMKTHEGDVVYGV-REEAPADEQQV 378

  Fly  1906 NNNSHASSDKLENPATPI 1923
            ....|...|:.|...|.|
  Fly   379 VEELHVDVDESEAAVTVI 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368 5/20 (25%)
C2H2 Zn finger 1756..1776 CDD:275368 7/19 (37%)
C2H2 Zn finger 1785..1806 CDD:275368 7/20 (35%)
C2H2 Zn finger 1814..1834 CDD:275368 6/19 (32%)
zf-C2H2 1839..1861 CDD:278523 5/21 (24%)
C2H2 Zn finger 1841..1861 CDD:275368 5/19 (26%)
C2H2 Zn finger 1868..1888 CDD:275368 8/19 (42%)
Sry-deltaNP_524581.1 COG5048 <205..360 CDD:227381 48/160 (30%)
C2H2 Zn finger 225..245 CDD:275368 7/19 (37%)
C2H2 Zn finger 253..273 CDD:275368 7/20 (35%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
C2H2 Zn finger 310..327 CDD:275370 4/16 (25%)
zf-C2H2 337..359 CDD:278523 8/21 (38%)
C2H2 Zn finger 339..359 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439966
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.