Sequence 1: | NP_001247289.1 | Gene: | mld / 2768685 | FlyBaseID: | FBgn0263490 | Length: | 1965 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001303488.1 | Gene: | CG17803 / 42141 | FlyBaseID: | FBgn0038547 | Length: | 587 | Species: | Drosophila melanogaster |
Alignment Length: | 233 | Identity: | 57/233 - (24%) |
---|---|---|---|
Similarity: | 86/233 - (36%) | Gaps: | 50/233 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 1714 VQVSELRTSHH---CLYCEERFTNEISLKKHHQLAHGALT------------TMPYVCTICKRGY 1763
Fly 1764 RMRTALHRHMESHDVEGRPYECNICRVRFPRPSQLTLHKITVHLLSKPHTCDECGKQFGTESALK 1828
Fly 1829 THIKFHGELGYQCDGCDRTFEYLKELRKHRRTHSEMF-YKCKFCPSSFMRFTNFRAHMKTHLPLG 1892
Fly 1893 VFRNEDAASKSPSNNNSHASSDKLENPATPIEETPLTP 1930 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mld | NP_001247289.1 | zf-AD | 186..255 | CDD:214871 | |
C2H2 Zn finger | 1365..1388 | CDD:275368 | |||
C2H2 Zn finger | 1396..1416 | CDD:275368 | |||
C2H2 Zn finger | 1424..1445 | CDD:275368 | |||
C2H2 Zn finger | 1725..1746 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 1756..1776 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 1785..1806 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 1814..1834 | CDD:275368 | 4/19 (21%) | ||
zf-C2H2 | 1839..1861 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 1841..1861 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 1868..1888 | CDD:275368 | 4/19 (21%) | ||
CG17803 | NP_001303488.1 | zf-AD | 86..160 | CDD:214871 | |
COG5048 | <323..528 | CDD:227381 | 46/188 (24%) | ||
zf-C2H2 | 324..346 | CDD:278523 | |||
C2H2 Zn finger | 326..346 | CDD:275368 | |||
C2H2 Zn finger | 354..375 | CDD:275368 | 1/5 (20%) | ||
C2H2 Zn finger | 383..401 | CDD:275368 | 7/17 (41%) | ||
C2H2 Zn finger | 426..446 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 454..474 | CDD:275368 | 9/48 (19%) | ||
C2H2 Zn finger | 481..501 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 509..528 | CDD:275368 | 4/18 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45439965 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |