DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and pzg

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_001262143.1 Gene:pzg / 40351 FlyBaseID:FBgn0259785 Length:996 Species:Drosophila melanogaster


Alignment Length:574 Identity:113/574 - (19%)
Similarity:195/574 - (33%) Gaps:156/574 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1420 QQYQCGQCSHVFPAQKALDVHIQRFHMTLKTDPSGAVKVEDVQLQITSERRPRGRPYKPRLQLQQ 1484
            :.|.|.:|:::......|:..::|    :||:   .:.:.:.:..|..:....|           
  Fly   127 EDYVCSRCTNLVNYYDRLENDVER----VKTN---LISLLNKKYAINEDMGQEG----------- 173

  Fly  1485 HQLQPQQKLQVQQHQQQQKALQQLPQAQHHQQQQQPQLQQEVLQQVQQLQVQVQPQQHQQHQQVL 1549
               .|..|:|........::|::.|.|    ...:|   :::||.....|.::.|...|...|..
  Fly   174 ---SPPLKMQKMVGGSANRSLEESPSA----DLLRP---RKLLQGNPVGQSKIAPGTTQSSVQGT 228

  Fly  1550 QVQQPQQQPLMQPQSPHPSTVEMQASPTTPRKILCCPDCEDCTSGHSHANEQFE--ELQTLQAPP 1612
            |                  ||:.:|:     ||..|..|:..||.....|..:|  :.||.|.  
  Fly   229 Q------------------TVQRKAT-----KIYKCTSCDYKTSDMRLFNTHYETCKQQTFQC-- 268

  Fly  1613 TVLTPPSTIVSVPSPQPMVYSQHITMPSPEQSEPDSTTTL--------RQYRKRGVIVGPQGPLH 1669
                  .|...: .|......||  |.....:..|:|..:        ...||           |
  Fly   269 ------KTCRKI-FPHFGAMKQH--MVRDHNTAMDNTCAMCHINFVNENSLRK-----------H 313

  Fly  1670 LATPVASPSPSSSPSSSTVDHIPPASPATPASPAPPPSPAVASTVQVSE--LRTS-HHCLYCEER 1731
            :.|            :...:.:..::...|||.||..:.|.|:....:|  :.|| :.|.:|:.:
  Fly   314 MET------------NHATNVLVTSTTTIPASAAPVAAAAAAAAAAANENLVGTSLYTCNHCQFK 366

  Fly  1732 FTNEISLKKHHQLAHGALTTMPYVCTICKRGYRMRTALHRHMESHDVEGRPYECNICRVRFPRPS 1796
            .|:::...:|.: .|.|....|:.|.:|.:.:..|.|...|.:.|....  ::|..|.:.||:..
  Fly   367 STDKVVFDEHMR-KHAAGKPKPFKCRLCSQRFETREAATVHAKQHQTNF--FKCGTCSMTFPKRE 428

  Fly  1797 QLTLHKITVHLLSKPHTCDECGKQ-----FGTESALKTHI--KFHGELGYQCDGCDRTFEYLKEL 1854
            .|..| ..||  ..|.......||     ..|:..|:..|  .....|.........|.|....:
  Fly   429 MLVKH-FEVH--QSPSASTVSPKQSVSQNLNTQKLLQETIDEALSDSLPASTAAVVATTESENNI 490

  Fly  1855 RKHRRTHSEMFYKCKFCPSSFMRFTNFRAHMKTHLPLGVFRNEDAASKSPSNNNSHASS------ 1913
            |         |:.|..|..:|::.|.:..||:||.     |::.|.|...:..||.|::      
  Fly   491 R---------FFSCSICSLTFIQETYYNHHMETHR-----RDKKATSAGATALNSAATALLSDEP 541

  Fly  1914 ------------------------DKLENPATPIEETPLTPMSSGGHLYHSPDE 1943
                                    :||.:......|.| .|.|.||.:..:..|
  Fly   542 GEATGKAGDESGEQNAEADIESLFEKLHSDKNESGEAP-KPGSKGGEMVITSQE 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368 4/20 (20%)
C2H2 Zn finger 1725..1746 CDD:275368 4/20 (20%)
C2H2 Zn finger 1756..1776 CDD:275368 5/19 (26%)
C2H2 Zn finger 1785..1806 CDD:275368 6/20 (30%)
C2H2 Zn finger 1814..1834 CDD:275368 5/26 (19%)
zf-C2H2 1839..1861 CDD:278523 3/21 (14%)
C2H2 Zn finger 1841..1861 CDD:275368 3/19 (16%)
C2H2 Zn finger 1868..1888 CDD:275368 6/19 (32%)
pzgNP_001262143.1 C2H2 Zn finger 241..263 CDD:275371 6/21 (29%)
C2H2 Zn finger 268..289 CDD:275371 5/31 (16%)
C2H2 Zn finger 297..318 CDD:275371 4/43 (9%)
C2H2 Zn finger 360..380 CDD:275368 4/20 (20%)
zf-H2C2_2 373..399 CDD:290200 6/26 (23%)
zf-C2H2_8 375..443 CDD:292531 19/73 (26%)
C2H2 Zn finger 390..410 CDD:275368 5/19 (26%)
C2H2 Zn finger 417..437 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439969
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.