DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and CG10654

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_001261767.1 Gene:CG10654 / 39428 FlyBaseID:FBgn0036294 Length:412 Species:Drosophila melanogaster


Alignment Length:188 Identity:52/188 - (27%)
Similarity:71/188 - (37%) Gaps:55/188 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1756 CTICKRGYRMRTALHRHMESHDVEG-RPYECNICRVRFPRPSQLTLHKITVH--------LLSKP 1811
            |.||.||:...:.|..||:.|  || |||.|..|...:.|.:.|..|...:|        :.:.|
  Fly   228 CRICHRGFYKPSLLEAHMQQH--EGLRPYTCVHCAKSYARANLLESHLRQMHNNADAARIIYACP 290

  Fly  1812 --------------------------------HTCDECGKQFGTESALKTHIKFHGEL---GYQC 1841
                                            |.|:||||.|..::.|..|...||.:   .|.|
  Fly   291 SCNKVYTANRSLKYHMRRTHERYHESESPDARHICEECGKCFARKAHLTRHKMVHGSVEGRRYCC 355

  Fly  1842 DGCDRTFEYLKE------LRKHRRTHSEMFYKCKFCPSSFMRFTNFRAHMKTHLPLGV 1893
            :.|||.| |.||      ||||  .:..:..:|:.|...|.......||.:.|..:.|
  Fly   356 ECCDRRF-YTKENMVDHLLRKH--GNKNLLLRCRKCGRIFQNSVELNAHGRKHKAMDV 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368
C2H2 Zn finger 1756..1776 CDD:275368 8/19 (42%)
C2H2 Zn finger 1785..1806 CDD:275368 5/20 (25%)
C2H2 Zn finger 1814..1834 CDD:275368 8/19 (42%)
zf-C2H2 1839..1861 CDD:278523 13/27 (48%)
C2H2 Zn finger 1841..1861 CDD:275368 12/25 (48%)
C2H2 Zn finger 1868..1888 CDD:275368 5/19 (26%)
CG10654NP_001261767.1 zf-AD 39..115 CDD:285071
C2H2 Zn finger 228..248 CDD:275368 8/19 (42%)
C2H2 Zn finger 256..313 CDD:275368 7/56 (13%)
C2H2 Zn finger 289..314 CDD:275368 1/24 (4%)
zf-C2H2 323..345 CDD:278523 9/21 (43%)
C2H2 Zn finger 325..345 CDD:275368 8/19 (42%)
C2H2 Zn finger 355..376 CDD:275368 10/21 (48%)
C2H2 Zn finger 385..405 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439967
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.