DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and CG2199

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_728599.1 Gene:CG2199 / 38159 FlyBaseID:FBgn0035213 Length:733 Species:Drosophila melanogaster


Alignment Length:487 Identity:93/487 - (19%)
Similarity:160/487 - (32%) Gaps:159/487 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1569 TVEMQASPTT-PRKILCCPDCEDCTSGHSHANEQFEELQTLQAPPTVLTPPSTIVSVPSPQPMVY 1632
            |:..::.|:: |.||     |..|||             |..:...::......|.....||...
  Fly    49 TITHRSIPSSLPIKI-----CFVCTS-------------TFMSSAALIEKVRETVDRVQEQPAKK 95

  Fly  1633 SQ--HITMPSPEQSE------PDSTTTLRQYRKRGVIVGPQGPLHLA---TPV----ASP----- 1677
            ::  .|..||.::|:      |...||||| |.:.:...|...::.|   |.:    |||     
  Fly    96 TKVAEIEEPSTQESDKKAVKVPKKNTTLRQ-RSKSIAAFPPSFVNGANTNTEIEIISASPKKLDK 159

  Fly  1678 SPSSSPSSSTVDHIPPASPATPASPAPPPSPAVAS--------TVQV---SE-----------LR 1720
            :|....|....|::..:...|||........|..:        .::|   ||           :.
  Fly   160 TPKKQISRLFEDNLNDSVKLTPAKEVSSTKKAFLNLFGNGGNDAIEVLTESEEEEDSDKGPITIN 224

  Fly  1721 TSH-HCLYCEERFTNEISLKKHHQLAHGALTTMPYVCTICKRGYRMRTALHRHM-ESHD------ 1777
            |:: .|..||.........|:|.|..||......|.||:|.:.:.:...|..|: ::|.      
  Fly   225 TNNFQCPECEFHAKFPKPYKEHLQKEHGLQRPRIYPCTLCIKTFGVLKTLKNHLRDTHSRTFESE 289

  Fly  1778 --------------------VEGRPYECN-ICRVRFPRPSQLTLHKITVHLLSKPHTCDECGKQF 1821
                                ::.:..|.| :.:.:.|:..:....|..:....:....||...|.
  Fly   290 AKTKAKESKEKEAKSGAKNKIDAKAKETNAVSQRKKPKEKKSKEKKTEIKCNVETKVVDEIDDQV 354

  Fly  1822 ----GT--------------------ESALKTHI-----------KFHGEL---------GYQCD 1842
                ||                    ||.:|..:           ..:|..         .:||:
  Fly   355 NNKKGTDSEDADQTQATKIASFKALNESLMKKRMLENVIDSEYTFAINGSSASTPRADSNNFQCE 419

  Fly  1843 GCDRTFEYLKELRKHRRT-HS---EMFYKCKFCPSSFMRFTNFRAHMKTHLPLGVFRNEDAASKS 1903
            .||......|::::|.:| ||   ...:||..|..|.....:.:.||..|        .|.| ::
  Fly   420 ICDCELMTAKQMQEHMKTVHSIDKPKVFKCHVCEKSLATKQSLKTHMTLH--------ADGA-EA 475

  Fly  1904 PSNNNSHASSD-----------KLENPATPIE 1924
            |:::......|           ::||.|..:|
  Fly   476 PNSSKRKILQDEDEDVDILGTTQIENTAEKVE 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368 6/20 (30%)
C2H2 Zn finger 1756..1776 CDD:275368 5/20 (25%)
C2H2 Zn finger 1785..1806 CDD:275368 3/21 (14%)
C2H2 Zn finger 1814..1834 CDD:275368 8/54 (15%)
zf-C2H2 1839..1861 CDD:278523 7/22 (32%)
C2H2 Zn finger 1841..1861 CDD:275368 6/20 (30%)
C2H2 Zn finger 1868..1888 CDD:275368 5/19 (26%)
CG2199NP_728599.1 C2H2 Zn finger 418..439 CDD:275370 6/20 (30%)
C2H2 Zn finger 449..469 CDD:275370 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439978
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.