DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and CG8089

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_611014.1 Gene:CG8089 / 36679 FlyBaseID:FBgn0033993 Length:624 Species:Drosophila melanogaster


Alignment Length:669 Identity:114/669 - (17%)
Similarity:181/669 - (27%) Gaps:301/669 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly  1380 YSRHIIDL-----HPAVAP--------------FNCPHCPMAFAGRTKRSQHILSHHVVQQY--- 1422
            |.|.:..|     |.|:.|              :.|.:.|.      |:.|.:..|....:|   
  Fly   139 YRRSVSQLAGQEAHGALRPKIAALFLPGLRCDCYKCENLPW------KKLQDVEDHQKTHRYSDN 197

  Fly  1423 -QCGQCSHVFPAQKALDVHIQRFHMTLKTDPSGAVKVEDVQLQITSERRPRGRPYKPRLQLQQHQ 1486
             .|..|...|..|.:|..||.|                    :.||.|             :.|:
  Fly   198 FHCQICYRRFYLQHSLTSHIIR--------------------KSTSSR-------------ELHE 229

  Fly  1487 LQPQQKLQVQQHQQQQKALQQLPQAQHHQQQQQPQLQQEVLQQVQQLQVQVQPQQHQQHQQVLQV 1551
            .:..::|...|..|::|.|:.                  .|.:|:.:.|.|              
  Fly   230 NKRYKRLLENQKSQEEKELEL------------------SLNKVEDILVPV-------------- 262

  Fly  1552 QQPQQQPLMQPQSPHPSTVEMQASPTTPRKILCCPDCEDCTSGHSHANEQFEELQTLQAPPTVLT 1616
             ....|...:.:|.||    :|...|:  .:..||.|..        |..|.             
  Fly   263 -AEDLQSYFKDESKHP----IQKRKTS--SLSKCPSCAQ--------NYGFS------------- 299

  Fly  1617 PPSTIVSVPSPQPMVYSQHITMPSPEQSEPDSTTTLRQYRKRGVIVGPQGPLHLATPVASPSPSS 1681
                           :|..:.|             ::..|:|         |:...|        
  Fly   300 ---------------FSHQLHM-------------VKHRRER---------LYTNFP-------- 319

  Fly  1682 SPSSSTVDHIPPASPATPASPAPPPSPAVASTVQVSELRTSHHCLYCEERFTNEISLKKHHQLAH 1746
                                                     .||.:|...|.....|:||.|...
  Fly   320 -----------------------------------------FHCSFCNRSFLTRKFLRKHQQRVR 343

  Fly  1747 --GALTTMPYVCTICKRGYRMRTALHRH----------------------------------MES 1775
              ..|...|:.|..|...:::::||..|                                  |:.
  Fly   344 TFSTLLYRPFKCPHCTWRFQLKSALDSHVLRIHERRKPCLICKLPTSRLCCSAHTSKECNRAMQK 408

  Fly  1776 HDVEGRPYE--------------CNICRVRFPRPSQLTLHKITVHLLSKPHTCDECGKQFGTESA 1826
            :..:.||..              |.||..:|.|...|..|....||..:..||:.||..|.::..
  Fly   409 YRDKMRPLREPPKGGCRKQPTPVCKICNRKFTRKFFLEEHMNKAHLNKRNFTCEICGANFYSQGT 473

  Fly  1827 LKTHIKFHGELGY--QCDGCDRTFEYLKELRKHRRTHSEMFYKCKFCPSSFMRFTNFRAHMKTHL 1889
            ::||.|....|.:  ||:.||.|.:.....|:|          ||           .::|....:
  Fly   474 MQTHRKAVHLLVHTVQCEVCDLTIKSKGNYRRH----------CK-----------SQSHKDNLV 517

  Fly  1890 PLGVFRNEDAASKSPSNNNSHASSDKLENPATPIEETPLTPMSSGGHLY------------HSPD 1942
            ..|  :|.|....|.....:..:.:||:..|:....|.:|..:...|.|            .:|.
  Fly   518 KFG--KNNDKTKDSNRRKGARTTDEKLDIEASSSTNTCMTSANKSTHNYKKMGIKTKQTHLKTPC 580

  Fly  1943 EYPNSV-----ESCAGNSV 1956
            .....|     |:| |||:
  Fly   581 RSKKRVKIKICETC-GNSI 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368 3/12 (25%)
C2H2 Zn finger 1396..1416 CDD:275368 4/19 (21%)
C2H2 Zn finger 1424..1445 CDD:275368 8/20 (40%)
C2H2 Zn finger 1725..1746 CDD:275368 7/20 (35%)
C2H2 Zn finger 1756..1776 CDD:275368 6/53 (11%)
C2H2 Zn finger 1785..1806 CDD:275368 7/20 (35%)
C2H2 Zn finger 1814..1834 CDD:275368 7/19 (37%)
zf-C2H2 1839..1861 CDD:278523 7/23 (30%)
C2H2 Zn finger 1841..1861 CDD:275368 6/19 (32%)
C2H2 Zn finger 1868..1888 CDD:275368 3/19 (16%)
CG8089NP_611014.1 C2H2 Zn finger 289..309 CDD:275368 7/68 (10%)
C2H2 Zn finger 322..343 CDD:275368 7/20 (35%)
C2H2 Zn finger 355..376 CDD:275368 5/20 (25%)
C2H2 Zn finger 432..453 CDD:275368 7/20 (35%)
C2H2 Zn finger 461..486 CDD:275368 8/24 (33%)
C2H2 Zn finger 490..506 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439968
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.