DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and ZNF445

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_852466.1 Gene:ZNF445 / 353274 HGNCID:21018 Length:1031 Species:Homo sapiens


Alignment Length:1106 Identity:216/1106 - (19%)
Similarity:341/1106 - (30%) Gaps:377/1106 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   949 LELTQFLRDLQPSQ-------SDPPAGEQVEKIEMETQPSTVQMDVQSNLPVQAADTQPQNESAN 1006
            |.|.||| .:.|.:       .:|.:||:...:..|.|........:...|.|:.|.......|.
Human    98 LVLEQFL-SILPGELRVWVQLHNPESGEEAVALLEELQRDLDGTSWRDPGPAQSPDVHWMGTGAL 161

  Fly  1007 HSPFESPISSP-QVQSQIELQMEPQIETQMQPQIETRMQHDVLSVQSPQNHQPQVQSHDQSQMQH 1070
            .|.....::|| :..|.:...:||..|      ||.|   |.|:.||         ....:||..
Human   162 RSAQIWSLASPLRSSSALGDHLEPPYE------IEAR---DFLAGQS---------DTPAAQMPA 208

  Fly  1071 QIPPQIEPQIEVQNQEQNTLQLVPQAQHQVVPHVQLQSQLVPHVQTQGTTT----TVTYEQ---- 1127
            ..|.:..|                  ..||.|...|.:||      |.|.|    .||:.|    
Human   209 LFPREGCP------------------GDQVTPTRSLTAQL------QETMTFKDVEVTFSQDEWG 249

  Fly  1128 --------IYQQHIVQQTVQQSSNKMQVISLPSAGS--ETTRQWQTQQSQQQQQVQWSSVGGLEA 1182
                    :|:. ::.:..:..::.:...:.|:..|  |....|.......|.            
Human   250 WLDSAQRNLYRD-VMLENYRNMASLVGPFTKPALISWLEAREPWGLNMQAAQP------------ 301

  Fly  1183 IKSAPVESVAPT-------TTTYYISASDLYPQQTETYTMLQPASNESYVI------EQVNHQQQ 1234
             |..||  .|||       |..:.::...|...:|...:...||::.|..|      :|.:.|:.
Human   302 -KGNPV--AAPTGDDLQSKTNKFILNQEPLEEAETLAVSSGCPATSVSEGIGLRESFQQKSRQKD 363

  Fly  1235 HCQQQIQMSQQQHQRQHQQQQAQQQQQPIMILIQQPEIQQPVASASNPQQAPLHIYNAATSNDVH 1299
            .|:..||:..::.:.....:..:..:                .|.||..... |:.....|....
Human   364 QCENPIQVRVKKEETNFSHRTGKDSE----------------VSGSNSLDLK-HVTYLRVSGRKE 411

  Fly  1300 QMQHTQRQQIRQQYQHQQYQRLQQPQQTRV--------------------------VQSHPVLGM 1338
            .::|...:..|....|..|::..:..:..:                          :.||...|.
Human   412 SLKHGCGKHFRMSSHHYDYKKYGKGLRHMIGGFSLHQRIHSGLKGNKKDVCGKDFSLSSHHQRGQ 476

  Fly  1339 PGAT-SISTKVTPIPVTAARGRPL-----------TLKCRFCHNGPRFSSSLEYSRHIIDLHPAV 1391
            ...| .:|.|.:....|.:....|           ..|||.|....|:||:.  :|| ..:|..|
Human   477 SLHTVGVSFKCSDCGRTFSHSSHLAYHQRLHTQEKAFKCRVCGKAFRWSSNC--ARH-EKIHTGV 538

  Fly  1392 APFNCPHCPMAF----AGRTKRSQHI-------------------LSHHVVQQ-----YQCGQCS 1428
            .|:.|..|..||    |.|..|..|.                   ..||:..|     :.|.||.
Human   539 KPYKCDLCEKAFRRLSAYRLHRETHAKKKFLELNQYRAALTYSSGFDHHLGDQSGEKLFDCSQCR 603

  Fly  1429 HVFPAQKALDVHIQRFHMTLKTDPSGAVKVEDVQLQITSERRPRGRPYKP---------RLQLQQ 1484
            ..|..:..:..| ||.|                    |.|     :|||.         |....:
Human   604 KSFHCKSYVLEH-QRIH--------------------TQE-----KPYKCTKCRKTFRWRSNFTR 642

  Fly  1485 H-QLQPQQKLQVQQHQQQQKALQQLPQAQHHQQQQQPQLQQEVLQQVQQLQVQVQPQQHQQHQQV 1548
            | :|..::|...|  .:.::..:|.|...  |.|..|.:::..|.| |..:...:.:....||::
Human   643 HMRLHEEEKFYKQ--DECREGFRQSPDCS--QPQGAPAVEKTFLCQ-QCGKTFTRKKTLVDHQRI 702

  Fly  1549 LQVQQPQQQPLMQPQSPHPSTVEMQASPTTPRKILCCPDCEDCTSGHSHANEQFEELQTLQAPPT 1613
            ...::|.|                               |.||  |...|               
Human   703 HTGEKPYQ-------------------------------CSDC--GKDFA--------------- 719

  Fly  1614 VLTPPSTIVSVPSPQPMVYSQHITMPSPEQSEPDSTTTLRQYRKRGVIVGPQGPLHLATPVASPS 1678
                                                     ||...::       |.........
Human   720 -----------------------------------------YRSAFIV-------HKKKHAMKRK 736

  Fly  1679 PSSSPSSS--TVDHIPPASPATPASPAPPPSPAVASTVQVSELRTSHHCLYCEERFTNEISLKKH 1741
            |...||.|  ||..:|.:|    .|...|                 :.|..|.:.|.|...|..|
Human   737 PEGGPSFSQDTVFQVPQSS----HSKEEP-----------------YKCSQCGKAFRNHSFLLIH 780

  Fly  1742 HQLAHGALTTMPYVCTICKRGYRMRTALHRHMESHDVEGRPYEC-------NICRVRFPRPSQLT 1799
            .::..|   ..||.|..|.:.:|..:.|:||...|.:: :.|:|       |:      .|..||
Human   781 QRVHTG---EKPYKCRECGKAFRWSSNLYRHQRIHSLQ-KQYDCHESEKTPNV------EPKILT 835

  Fly  1800 LHKITVHLLSKPHTCDECGKQFGTESALKTHIKFH-GELGYQCDGCDRTFEYLKELRKHRRTHS- 1862
                    ..|...|.||||.|..:..|..|...| ||..|:|:.|.::::....|..|:|.|| 
Human   836 --------GEKRFWCQECGKTFTRKRTLLDHKGIHSGEKRYKCNLCGKSYDRNYRLVNHQRIHST 892

  Fly  1863 EMFYKCKFCPSSFMRFTNFRAHMKTHLPLGVFRNEDAASKSPSNNNSHASSDKLENPATPIEETP 1927
            |..:||::|...|:......:|.:.|.     |...|....|:.::|..:..:|:. ..|.||.|
Human   893 ERPFKCQWCGKEFIGRHTLSSHQRKHT-----RAAQAERSPPARSSSQDTKLRLQK-LKPSEEMP 951

  Fly  1928 L 1928
            |
Human   952 L 952

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368 8/22 (36%)
C2H2 Zn finger 1396..1416 CDD:275368 8/42 (19%)
C2H2 Zn finger 1424..1445 CDD:275368 7/20 (35%)
C2H2 Zn finger 1725..1746 CDD:275368 6/20 (30%)
C2H2 Zn finger 1756..1776 CDD:275368 6/19 (32%)
C2H2 Zn finger 1785..1806 CDD:275368 5/27 (19%)
C2H2 Zn finger 1814..1834 CDD:275368 8/19 (42%)
zf-C2H2 1839..1861 CDD:278523 6/21 (29%)
C2H2 Zn finger 1841..1861 CDD:275368 5/19 (26%)
C2H2 Zn finger 1868..1888 CDD:275368 4/19 (21%)
ZNF445NP_852466.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
SCAN 51..155 CDD:128708 14/57 (25%)
KRAB 234..292 CDD:214630 8/58 (14%)
C2H2 Zn finger 415..451 CDD:275368 4/35 (11%)
COG5048 <457..643 CDD:227381 45/214 (21%)
C2H2 Zn finger 460..479 CDD:275368 3/18 (17%)
C2H2 Zn finger 487..507 CDD:275368 2/19 (11%)
C2H2 Zn finger 515..535 CDD:275368 8/22 (36%)
C2H2 Zn finger 543..563 CDD:275368 7/19 (37%)
COG5048 595..1031 CDD:227381 107/530 (20%)
C2H2 Zn finger 599..619 CDD:275368 7/20 (35%)
C2H2 Zn finger 627..647 CDD:275368 2/19 (11%)
C2H2 Zn finger 683..703 CDD:275368 4/20 (20%)
C2H2 Zn finger 711..731 CDD:275368 8/84 (10%)
C2H2 Zn finger 764..784 CDD:275368 6/19 (32%)
C2H2 Zn finger 792..812 CDD:275368 6/19 (32%)
C2H2 Zn finger 842..862 CDD:275368 8/19 (42%)
C2H2 Zn finger 870..890 CDD:275368 5/19 (26%)
C2H2 Zn finger 898..918 CDD:275368 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..939 6/32 (19%)
C2H2 Zn finger 953..972 CDD:275368 216/1106 (20%)
C2H2 Zn finger 980..1000 CDD:275368
C2H2 Zn finger 1008..1028 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24376
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.