DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mld and zgc:66472

DIOPT Version :9

Sequence 1:NP_001247289.1 Gene:mld / 2768685 FlyBaseID:FBgn0263490 Length:1965 Species:Drosophila melanogaster
Sequence 2:NP_956106.2 Gene:zgc:66472 / 327494 ZFINID:ZDB-GENE-030131-5705 Length:556 Species:Danio rerio


Alignment Length:541 Identity:103/541 - (19%)
Similarity:187/541 - (34%) Gaps:136/541 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1451 DPSGA---VKVEDVQLQITSE------------RRPRGRPYKPRLQLQQHQLQPQQKLQVQQHQQ 1500
            ||..|   ..:|.:.:..|||            |....|.:|....|:||    .:|.:    |:
Zfish     5 DPLSAKFRTLIERLMVATTSEIVKIFSKVLLETRVEITRSWKEIDLLKQH----LEKCE----QE 61

  Fly  1501 QQKALQQLPQAQHHQQQQQPQLQQEVLQQVQQLQVQVQPQQHQQHQQVLQVQQP------QQQPL 1559
            :::|:.:..::...::..:.:     :.|.:|.....:|:......:..:|.:.      :.:..
Zfish    62 KREAIIRAQRSDFKREDDEME-----VSQFKQSYNSDKPRASGSKARTGKVSKDRCVSVGKTKVT 121

  Fly  1560 MQPQSPHPSTVEMQASPTTPRKILCCPDCEDCTSGHSHANEQFEELQTLQAPPTVLTPPSTIVSV 1624
            .|...|..|..:::...|...|..|               .:|...:.:..||            
Zfish   122 AQSSKPGSSGKKVKTQKTNSPKTKC---------------TEFVARRKVGRPP------------ 159

  Fly  1625 PSPQPMVYSQH---ITMPSPEQSEPDSTTTLRQYRKRGVIVGPQGPLHLATPVASPSPSSSPSSS 1686
            ...:.|..|.|   ||:...:..:.|.                          ||.|.....:|.
Zfish   160 KKQKSMSISSHTIPITVDDDDDDDDDE--------------------------ASASVDFQTTSP 198

  Fly  1687 TVDHIPPASPATPASPAPPPSPAVASTVQVSE-LRTSHHCLYCEERFTNEIS--LKKHHQLAHGA 1748
            .|..:...:  ..::|..|....|:..::..: |....|||.|.....|:.|  .|..||:    
Zfish   199 KVKEMKKEN--VTSTPTHPNDANVSRGLRDRQHLGMQRHCLCCSSDECNKQSSPSKAQHQV---- 257

  Fly  1749 LTTMPYVCTICKRGYRMRTALHRHMESHDVEGRPYECNICRVRFPRPSQLTLHKITVHLLSKPHT 1813
              ...|:|..|:|  |.:|.|  ..:||.. ..|..|:.|...|.....|..|:..|   ..|.:
Zfish   258 --PTVYICRKCER--RFKTDL--QFKSHKC-SMPQNCDKCGQVFNTLQGLFTHRQEV---QPPLS 312

  Fly  1814 CDECGKQFGTESALKTHIKFHGELGYQCDGCDRTFEYLKELRKHRRTHSEMFYKCKFCPS-SFMR 1877
            |.:|.::|.|..|...|.|.|..|....:...:.|    |:|..|.:.|::  :...|.| |:::
Zfish   313 CSQCEEKFATLCAWAVHKKIHTNLIIPKEIKSKRF----EVRLERISDSQL--EAALCSSGSYLQ 371

  Fly  1878 FTNFRAHMKTHLPLGVFRNEDAAS-KSPSNNNSHASSDKLENPATPIEETPLTPMSSGGHLYHSP 1941
            ..:.:            :|.|..: .:...||..|.....|:....:.::.:|.:||     .|.
Zfish   372 NNSSK------------QNSDVQNVNATETNNGSACERGAESTMENLPDSSMTQLSS-----QSS 419

  Fly  1942 DEYPNSVESCAGNSVALESYA 1962
            .|  :.::|..|.|...:.||
Zfish   420 AE--SLLDSSGGQSSVRKVYA 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldNP_001247289.1 zf-AD 186..255 CDD:214871
C2H2 Zn finger 1365..1388 CDD:275368
C2H2 Zn finger 1396..1416 CDD:275368
C2H2 Zn finger 1424..1445 CDD:275368
C2H2 Zn finger 1725..1746 CDD:275368 8/22 (36%)
C2H2 Zn finger 1756..1776 CDD:275368 6/19 (32%)
C2H2 Zn finger 1785..1806 CDD:275368 5/20 (25%)
C2H2 Zn finger 1814..1834 CDD:275368 7/19 (37%)
zf-C2H2 1839..1861 CDD:278523 4/21 (19%)
C2H2 Zn finger 1841..1861 CDD:275368 4/19 (21%)
C2H2 Zn finger 1868..1888 CDD:275368 3/20 (15%)
zgc:66472NP_956106.2 C2H2 Zn finger 263..282 CDD:275368 8/23 (35%)
C2H2 Zn finger 287..304 CDD:275368 4/16 (25%)
C2H2 Zn finger 313..333 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595412
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.